Gene mpn104 (MPN104)
Name
mpn104
Stable ID
MPN104
Location
134583 - 134897 +
Sequence
    1  ATGGTAGAAC TTGATGGTAA GTTTGCTACT AAAGCTGATT TAAAACGGGT TGAAGATAAA
   61  GTTGATGTTT TGTTTGAATT GCAAAAAACG CAAGGTGAAC AAATCAAGGT TCAAGGAAAA
  121  CAAATCGAAC AGTTAACTGA AACTGTTCAA AAACAGGGCG AACAAATAAA GGAACTTCAA
  181  GTTCAGGTAA AAGCCCAAGG TGAAGAAATA AAAGAAATTA AAGTTGAACA AAAAGCTCAA
  241  GGCCAAACCT TGCAGTTAAT TCTGAAAGCA CTTGAAGGAA TAAACAAGCG ACTAGATAAT
  301  TTGGAATCGA AATAA
Download Sequence
Operon
OP47
Operon location
134212 - 135300
Protein (mpn104)
Name
Uncharacterized protein MPN_104
Stable ID
Mpn104
Molecular Weight
11440
Isoelectric Point
5
Localization
Cytoplasm
Comment -
Sequence
MVELDGKFATKADLKRVEDKVDVLFELQKTQGEQIKVQGKQIEQLTETVQKQGEQIKELQVQVKAQGEEIKEIKVEQKAQ
GQTLQLILKALEGINKRLDNLESK
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Methylation mVELDGKFAtk 1 12 K
Methylation mVELDGkFAtk 1 12 K
Oxidation mVELDGKFAtk 1 12 M
Oxidation mVELDGkFAtk 1 12 M
Phosphorylation mVELDGKFAtk 1 12 T
Phosphorylation mVELDGkFAtk 1 12 T
GENE/PROTEIN mpn104 (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
4-70 PF01519 (IPR002862) Domain of unknown function DUF16 0.0000002
13-75 G3DSA:3.40.1350.10 (IPR011856) Endonuclease TnsA, N-terminal/resolvase Hjc/tRNA e Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003676'>'nucleic' == '' ? '': 'nucleic'; 'acid' == '' ? '': 'acid'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003676) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004518'>'nuclease' == '' ? '': 'nuclease'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004518)

0.000032
63-103 PF01519 (IPR002862) Domain of unknown function DUF16 0.0000000075
Protein Homology (BLASTP results)
No homologous proteins were found using a BLAST search
External IDs
Gene ID
877156
GI
13507843
GO
Cell motility and secretion
Home COG
N
InterPro
IPR002862|Protein of unknown function DUF16
Old MP number
MP050
Pathway
Cytoskeleton?  Motility?
PDB homologs
2ba2
Pfam
PF01519
PID
g1673700
RefSeq
NP_109792.1
Swiss-Prot protein ID
Y104_MYCPN
phylomeDB tree
Y104_MYCPN
UniProt
P75565
Transcription
IMAGE BROWSERS

OPERON OP47 (Genomic Overview)
Region:134212-135300

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn104STRING legend

PDB image(s)

2ba2

PDB 2ba2