Gene deoA (MPN064)
Name
deoA
Stable ID
MPN064
Location
80414 - 81679 +
Sequence
    1  ATGAACATCG TTAACCTTAT TAGTAAAAAG CAACGCGGCA AGGCGTTAAC GGAAACAGAA
   61  ATTAACTGGT TTGTCCATTC CGTTAATAAC AAAAGCTTGG CCGATTATCA GGTCAGTGCC
  121  TTTTTAATGG CAGTGTGATT TCAGGGGATG AATTCCAAGG AGTTGTTTTG TCTCACCAAA
  181  GCGATGGTGA AATCAGGAGA GAGCCTCCAC TTTAACCACC ACAGCAAGTT AAGTGTTGAC
  241  AAACACTCCA CTGGTGGTAT TGGTGACAAG GTTTCCATTG CTTTAATTCC AATCTTAACT
  301  GCCTTAGATT ACAGTGTCGC AAAACTGTCG GGTCGTGGTT TGGGCTACAC TGGTGGCACA
  361  ATTGACAAAT TGGAAGCAGT GGGAGTAAAA ACAGATTTTA CACCAACAGA GGCGCAGAAC
  421  TTACTAGACC AAAATGACTG CTTTATTATT GGTCAAAGTG AGGGCATTGC TCCCGTAGAC
  481  AAGGTGTTGT ATGCACTACG CGATACTACG GCAACTGTGG ACAGTCTGCC CTTAATTGCT
  541  TCCAGTGTCA TGTCGAAGAA GTTGGCAATT AACAACGACT ACATCTTCAT TGACCTTAAG
  601  TACGGTAAGG GCGCTTTCTG TAAAACGAAG ACGATGGCTA AAGAGCTAGC GCAGTACATG
  661  TACAGTATTG CCAAGCAGTT TAAGCGCAAA CTCTACATTA AACTAAGTGA CATGAACCAG
  721  GTTTTGGGTA AAACGATTGG TAATGCGTTA GAGGTCTTGG AAGTAGTGCA CTTCTTAAAA
  781  CGGAATTGAA CTGAAGTGGG TGCTGACTTT ATTCAGTTGA TGGAGCAAAT AGTCACTGAA
  841  ATCCTTATAG AAACAAAACG TGCACCAAAC AAACGGGCAG CTGTAGCACT TTACCACGCT
  901  ACATTAGAGG GCGAAAAACC ATGGCAGCGT TTTTTAAAAT TTATTGAGCT GCAAGGTAGT
  961  AGTTGGGAAC GTTTTTTGGA TTTAAAAGAG CTGTTTAATC CCCAGTATAA AGCGCCAGTG
 1021  TTAGCATCTC AAAGTGGTAC TTTGAGCTAT ACCAGTCCGG TGGATTTAGC CATGGTCTCG
 1081  ATTAGCTTAG GTGCTGGTCG AATGGTTAAA ACAGATCTGA TTGACCCAAT GGCGGGGATT
 1141  AAGTTAGTGA AACAAGCTAA CGAAGTGGTA AAAGCTGGGG ACACAGTCTT AGAACTTTAC
 1201  AGCTCCAAAC CAATTACGCC TGCCCACATA GAAGCTGCGC AGCACACCAT TATTATTAAG
 1261  CAGTAA
Download Sequence
Operon
OP25
Operon location
79008 - 83850
Protein (mpn064)
Name
Thymidine phosphorylase (EC 2.4.2.4) (TdRPase)
Stable ID
Mpn064
Molecular Weight
46310
Isoelectric Point
9
Localization
Cytoplasm
Comment thymidine phosphorylase; Thymidine + Phosphate = Thymin + deoxyribose 1-phosphate.
Sequence
MNIVNLISKKQRGKALTETEINWFVHSVNNKSLADYQVSAFLMAVWFQGMNSKELFCLTKAMVKSGESLHFNHHSKLSVD
KHSTGGIGDKVSIALIPILTALDYSVAKLSGRGLGYTGGTIDKLEAVGVKTDFTPTEAQNLLDQNDCFIIGQSEGIAPVD
KVLYALRDTTATVDSLPLIASSVMSKKLAINNDYIFIDLKYGKGAFCKTKTMAKELAQYMYSIAKQFKRKLYIKLSDMNQ
VLGKTIGNALEVLEVVHFLKRNWTEVGADFIQLMEQIVTEILIETKRAPNKRAAVALYHATLEGEKPWQRFLKFIELQGS
SWERFLDLKELFNPQYKAPVLASQSGTLSYTSPVDLAMVSISLGAGRMVKTDLIDPMAGIKLVKQANEVVKAGDTVLELY
SSKPITPAHIEAAQHTIIIKQ
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mNIVNLISK 1 10 M
Oxidation mNIVNLISk 1 10 M
Oxidation mNIVNLISKK 1 11 M
Oxidation mNIVNLISKKQR 1 13 M
Oxidation SLADYQVSAFLmAVWFQGmNSK 32 54 M
Oxidation VLYALRDTTATVDSLPLIASSVmSK 162 187 M
Oxidation DTTATVDSLPLIASSVmSK 168 187 M
Oxidation DTTATVDSLPLIASSVmSk 168 187 M
Oxidation DTTATVDSLPLIASSVmSKK 168 188 M
Oxidation TmAKELAQYmYSIAK 211 226 M
Oxidation ELAQYmYSIAK 215 226 M
Oxidation LYIKLSDmNQVLGK 231 245 M
Oxidation LSDmNQVLGK 235 245 M
Oxidation lSDmNQVLGK 235 245 M
Oxidation LSDmNQVLGk 235 245 M
Methylation AAVALYHATLEGEkPWQR 293 311 K
Oxidation FLDLKELFNPQYKAPVLASQSGTLSYTSPVDLAmVSISLGAGR 325 368 M
Oxidation APVLASQSGTLSYTSPVDLAmVSISLGAGR 338 368 M
Oxidation mVKTDLIDPMAGIK 368 382 M
Oxidation mVKTDLIDPmAGIK 368 382 M
Oxidation MVKTDLIDPmAGIK 368 382 M
Oxidation TDLIDPmAGIK 371 382 M
Oxidation TDLIDPmAGIk 371 382 M
GENE/PROTEIN deoA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-67 G3DSA:1.20.970.10 (IPR020072) Glycosyl transferase, family 3, subgroup, N-termin 5.2e-27
1-70 SSF47648 (IPR017459) Glycosyl transferase, family 3, N-terminal 8.30001e-20
1-419 PTHR10515 (IPR000053) Pyrimidine-nucleoside phosphorylase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006206'>'pyrimidine' == '' ? '': 'pyrimidine'; 'base' == '' ? '': 'base'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006206)

0
1-421 PIRSF000478 (IPR000053) Pyrimidine-nucleoside phosphorylase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006206'>'pyrimidine' == '' ? '': 'pyrimidine'; 'base' == '' ? '': 'base'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006206)

0
3-66 PF02885 (IPR017459) Glycosyl transferase, family 3, N-terminal 0.00000000000031
3-420 TIGR02644 (IPR018090) Pyrimidine-nucleoside phosphorylase, bacterial/euk Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006213'>'pyrimidine' == '' ? '': 'pyrimidine'; 'nucleoside' == '' ? '': 'nucleoside'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006213)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016154'>'pyrimidine' == '' ? '': 'pyrimidine';-'nucleoside' == '' ? '': 'nucleoside'; 'phosphorylase' == '' ? '': 'phosphorylase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016154)

0
68-333 SSF52418 (IPR000312) Glycosyl transferase, family 3 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008152'>'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0008152)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0
72-334 G3DSA:3.40.1030.10 (IPR000312) Glycosyl transferase, family 3 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008152'>'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0008152)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0
78-306 PF00591 (IPR000312) Glycosyl transferase, family 3 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008152'>'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0008152)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

1e-27
110-125 PS00647 (IPR017872) Pyrimidine-nucleoside phosphorylase, conserved sit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006206'>'pyrimidine' == '' ? '': 'pyrimidine'; 'base' == '' ? '': 'base'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006206)

0
333-419 SSF54680 (IPR013102) Pyrimidine nucleoside phosphorylase, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006213'>'pyrimidine' == '' ? '': 'pyrimidine'; 'nucleoside' == '' ? '': 'nucleoside'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006213)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

2.60001e-19
335-420 G3DSA:3.90.1170.30 (n.a.) NULL 5.7e-18
347-420 SM00941 (IPR013102) Pyrimidine nucleoside phosphorylase, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006213'>'pyrimidine' == '' ? '': 'pyrimidine'; 'nucleoside' == '' ? '': 'nucleoside'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006213)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0.000000000000016
348-419 PF07831 (IPR013102) Pyrimidine nucleoside phosphorylase, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006213'>'pyrimidine' == '' ? '': 'pyrimidine'; 'nucleoside' == '' ? '': 'nucleoside'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006213)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

2.7e-17
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
6 396 390 - b4382 Escherichia coli 7 393 <1e-50 34.75 544
1 408 407 - MARTH_orf238 Mycoplasma arthritidis 1 405 <1e-50 41.5648 821
1 407 406 - MAG5120 Mycoplasma agalactiae 1 404 <1e-50 43.3824 821
1 421 420 - MCJ_005580 Mycoplasma conjunctivae 1 420 <1e-50 40.0468 739
1 405 404 - MCJ_005590 Mycoplasma conjunctivae 1 401 <1e-50 39.6552 714
5 416 411 - MCAP_0757 Mycoplasma capricolum subsp. capricolum 6 415 <1e-50 38.2567 739
1 417 416 - MYCGA5840 Mycoplasma gallisepticum 1 415 <1e-50 49.1607 1051
1 421 420 - MG051 Mycoplasma genitalium 1 421 <1e-50 67.4584 1515
1 411 410 - MHP7448_0083 Mycoplasma hyopneumoniae 7448 1 406 <1e-50 37.2881 697
1 407 406 - MHO_3340 Mycoplasma hominis 1 405 <1e-50 44.1176 878
1 405 404 - MMOB5360 Mycoplasma mobile 1 403 <1e-50 38.9706 701
5 407 402 - MSC_0830 Mycoplasma mycoides subsp. mycoides SC 6 406 <1e-50 39.1089 741
1 421 420 - MYPE1050 Mycoplasma penetrans 1 419 <1e-50 39.0995 798
5 137 132 - Lactococcus lactis subsp. lactis KF147 3 135 0.00000002 27.9412 127
2 419 417 - Lactococcus lactis subsp. lactis KF147 4 415 <1e-50 37.7088 687
1 411 410 - MS53_0446 Mycoplasma synoviae 1 409 <1e-50 41.2621 768
5 404 399 - Rv3314c Mycobacterium tuberculosis 10 395 <1e-50 35.2217 603
1 403 402 - Bacillus subtilis subsp. subtilis 1 401 <1e-50 41.8317 776
1 403 402 - Bacillus subtilis subsp. subtilis 1 401 <1e-50 41.8317 776
1 416 415 - Mycoplasma pulmonis 1 413 <1e-50 42.9257 874
External IDs
COG
COG0213F
EC number
2.4.2.4
Gene ID
876960
GI
13507803
GO
Nucleotide transport and metabolism
Home COG
F
InterPro
IPR000053|Pyrimidine-nucleoside phosphorylase
InterPro
IPR000312|Glycosyl transferase, family 3
InterPro
IPR002198|Short-chain dehydrogenase/reductase SDR
InterPro
IPR013102|Pyrimidine nucleoside phosphorylase, C-terminal
Old MP number
MP090
Pathway
Metabolism Nucleotides? tRNA modification?
PDB homologs
1brw_A
PDB homologs
1azy_A
PDB homologs
1otp_
PDB homologs
1TPT
Pfam
PF00591
Pfam
PF02885
Pfam
PF07831
PID
g1673745
RefSeq
NP_109752.1
Swiss-Prot protein ID
TYPH_MYCPN
phylomeDB tree
TYPH_MYCPN
UniProt
P75052
Transcription
IMAGE BROWSERS

OPERON OP25 (Genomic Overview)
Region:79008-83850

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn064STRING legend

PDB image(s)

1brw

PDB 1brw

1azy

PDB 1azy

1otp

PDB 1otp

1TPT

PDB 1TPT