Gene rplA (MPN220)
Name
rplA
Stable ID
MPN220
Location
272462 - 273142 +
Sequence
    1  ATGGCTAAAC TATCAAAGAA AATGAAGATA GCTGTTGGTT TGGTCGATAA AACCAAGCTG
   61  TACCCGCTCC AAGAAGCAGT TGATTTAGTC AAAAAAACTT CAATTACCAA ATTTAATGGC
  121  TCAGTTGATA TTGCCGTTAG CCTTAATTTA GACACCACCA AGGCGGAACA ACAGCTCCGC
  181  GGTGCGATTG CTTTTCCTCA CAGTGTTGGC AAACCAATCC GTATTCTAGC GATCACCGAT
  241  GATGAAAAGG CGGCACTGGA AGCAGGTGCT GACTTTGTTG GTGGCATTGA CAAGATCAAT
  301  GACATTAAAA ACGGTTGACT AGACTTTGAC CTGATCATCA CTTCTCCAAA GTTTATGGCC
  361  GCATTAGGTA AACTCGGGAA GCTGTTAGGT ACCAAGGGTT TAATGCCTAA CCCAAAAACA
  421  GAAACCGTTA CTGATGATGT TCCAGCTGCT GTACGCGCTT ACAAGAAGGG GAAAAAGGAA
  481  TACCGCGCTG ACAGCTTTGG TAACATCCAC ATGTCCTTAG GCCGCGTGGA CAGTGCGTCC
  541  AACCACTTGG TTGAAAACGC TTTGGCACTG CTTGATCTCA TTAAATCACG TAAACCAGCA
  601  ACCGTTAAAG GAATTTACAT TAAGAACATT GCCTTGACCA CTACCATGGG TCCGAGCTTA
  661  AAGGTTAAGC TCCCTGATTA A
Download Sequence
Operon
OP93
Operon location
265662 - 273150
Protein (mpn220)
Name
50S ribosomal protein L1
Stable ID
Mpn220
Molecular Weight
24860
Isoelectric Point
10
Localization
Cytoplasm
Comment -
Sequence
MAKLSKKMKIAVGLVDKTKLYPLQEAVDLVKKTSITKFNGSVDIAVSLNLDTTKAEQQLRGAIAFPHSVGKPIRILAITD
DEKAALEAGADFVGGIDKINDIKNGWLDFDLIITSPKFMAALGKLGKLLGTKGLMPNPKTETVTDDVPAAVRAYKKGKKE
YRADSFGNIHMSLGRVDSASNHLVENALALLDLIKSRKPATVKGIYIKNIALTTTMGPSLKVKLPD
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mKIAVGLVDKTK 8 20 M
Oxidation FmAALGK 118 125 M
Oxidation FmAALGKLGKLLGTK 118 133 M
Oxidation GLmPNPK 133 140 M
Oxidation GLmPNPKTETVTDDVPAAVR 133 153 M
Oxidation aDSFGNIHmSLGR 163 176 M
Oxidation ADSFGNIHmSLGr 163 176 M
Oxidation ADSFGNIHmSLGR 163 176 M
Oxidation KPATVKGIYIKNIALTTTmGPSLK 198 222 M
Oxidation NIALTTTmGPSLk 209 222 M
Oxidation NIALTTTmGPSLK 209 222 M
GENE/PROTEIN rplA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-225 PIRSF002155 (IPR002143) Ribosomal protein L1 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006396'>'RNA' == '' ? '': 'RNA'; 'processing' == '' ? '': 'processing'; ('GO' == '' ? '': 'GO';:0006396)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003723'>'RNA' == '' ? '': 'RNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003723)

0
3-226 TIGR01169 (IPR005878) Ribosomal protein L1, bacterial-type Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006412'>'translation' == '' ? '': 'translation'; ('GO' == '' ? '': 'GO';:0006412)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015934'>'large' == '' ? '': 'large'; 'ribosomal' == '' ? '': 'ribosomal'; 'subunit' == '' ? '': 'subunit'; ('GO' == '' ? '': 'GO';:0015934)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003723'>'RNA' == '' ? '': 'RNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003723) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003735'>'structural' == '' ? '': 'structural'; 'constituent' == '' ? '': 'constituent'; 'of' == '' ? '': 'of'; 'ribosome' == '' ? '': 'ribosome'; ('GO' == '' ? '': 'GO';:0003735)

0
6-226 SSF56808 (IPR002143) Ribosomal protein L1 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006396'>'RNA' == '' ? '': 'RNA'; 'processing' == '' ? '': 'processing'; ('GO' == '' ? '': 'GO';:0006396)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003723'>'RNA' == '' ? '': 'RNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003723)

0
15-219 PF00687 (IPR002143) Ribosomal protein L1 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006396'>'RNA' == '' ? '': 'RNA'; 'processing' == '' ? '': 'processing'; ('GO' == '' ? '': 'GO';:0006396)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003723'>'RNA' == '' ? '': 'RNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003723)

0
16-68 G3DSA:3.30.190.20 (IPR016094) Ribosomal protein L1, 2-layer alpha/beta-sandwich Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006412'>'translation' == '' ? '': 'translation'; ('GO' == '' ? '': 'GO';:0006412)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005622'>'intracellular' == '' ? '': 'intracellular'; ('GO' == '' ? '': 'GO';:0005622) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005840'>'ribosome' == '' ? '': 'ribosome'; ('GO' == '' ? '': 'GO';:0005840)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003735'>'structural' == '' ? '': 'structural'; 'constituent' == '' ? '': 'constituent'; 'of' == '' ? '': 'of'; 'ribosome' == '' ? '': 'ribosome'; ('GO' == '' ? '': 'GO';:0003735)

3.8e-39
21-223 PTHR23105:SF5 (n.a.) NULL 0
21-223 PTHR23105 (n.a.) NULL 0
69-157 G3DSA:3.40.50.790 (IPR016095) Ribosomal protein L1, 3-layer alpha/beta-sandwich Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006412'>'translation' == '' ? '': 'translation'; ('GO' == '' ? '': 'GO';:0006412)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005622'>'intracellular' == '' ? '': 'intracellular'; ('GO' == '' ? '': 'GO';:0005622) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005840'>'ribosome' == '' ? '': 'ribosome'; ('GO' == '' ? '': 'GO';:0005840)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003735'>'structural' == '' ? '': 'structural'; 'constituent' == '' ? '': 'constituent'; 'of' == '' ? '': 'of'; 'ribosome' == '' ? '': 'ribosome'; ('GO' == '' ? '': 'GO';:0003735)

5e-31
119-137 PS01199 (IPR002143) Ribosomal protein L1 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006396'>'RNA' == '' ? '': 'RNA'; 'processing' == '' ? '': 'processing'; ('GO' == '' ? '': 'GO';:0006396)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003723'>'RNA' == '' ? '': 'RNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003723)

0
159-223 G3DSA:3.30.190.20 (IPR016094) Ribosomal protein L1, 2-layer alpha/beta-sandwich Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006412'>'translation' == '' ? '': 'translation'; ('GO' == '' ? '': 'GO';:0006412)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005622'>'intracellular' == '' ? '': 'intracellular'; ('GO' == '' ? '': 'GO';:0005622) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005840'>'ribosome' == '' ? '': 'ribosome'; ('GO' == '' ? '': 'GO';:0005840)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003735'>'structural' == '' ? '': 'structural'; 'constituent' == '' ? '': 'constituent'; 'of' == '' ? '': 'of'; 'ribosome' == '' ? '': 'ribosome'; ('GO' == '' ? '': 'GO';:0003735)

3.8e-39
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
1 222 221 - b3984 Escherichia coli 1 224 2e-39 39.7321 392
3 224 221 - MARTH_orf143 Mycoplasma arthritidis 4 229 <1e-50 47.7876 488
2 224 222 - MAG0810 Mycoplasma agalactiae 3 229 9.94922e-44 43.6123 424
1 224 223 - MCJ_002660 Mycoplasma conjunctivae 1 228 <1e-50 49.1304 508
1 224 223 - MCAP_0066 Mycoplasma capricolum subsp. capricolum 1 226 <1e-50 50 537
13 224 211 - MYCGA6650 Mycoplasma gallisepticum 14 225 <1e-50 58.9623 684
1 226 225 - MG082 Mycoplasma genitalium 1 226 <1e-50 74.7788 885
1 224 223 - MHP7448_0459 Mycoplasma hyopneumoniae 7448 1 228 <1e-50 46.4912 503
1 224 223 - MHO_0880 Mycoplasma hominis 1 229 <1e-50 44.9782 469
17 226 209 - MMOB1390 Mycoplasma mobile 20 233 <1e-50 46.9767 483
1 224 223 - MSC_0995 Mycoplasma mycoides subsp. mycoides SC 1 226 <1e-50 50 530
16 222 206 - MYPE260 Mycoplasma penetrans 20 228 <1e-50 44.0191 470
15 222 207 - LIC_10750 Leptospira interrogans serovar Copenhage 14 220 2e-38 39.0476 383
3 224 221 - MS53_0623 Mycoplasma synoviae 4 229 1.4013e-45 42.9204 438
1 222 221 - Rv0641 Mycobacterium tuberculosis 1 224 1e-34 40.1786 351
1 222 221 - Lactococcus lactis subsp. lactis KF147 1 224 <1e-50 46.875 505
1 224 223 - Caulobacter crescentus NA1000 1 224 2e-30 33.6283 315
1 222 221 - Bacillus subtilis subsp. subtilis 1 224 <1e-50 45.5357 466
1 222 221 - Bacillus subtilis subsp. subtilis 1 224 <1e-50 45.5357 466
1 224 223 - Mycoplasma pulmonis 1 228 <1e-50 47.8261 508
External IDs
Gene ID
877074
GI
13507959
GO
Translation, ribosomal structure and biogenesis
Home COG
J
InterPro
IPR002143|Ribosomal protein L1
InterPro
IPR005878|Ribosomal protein L1, bacterial and chloroplast form
Old MP number
MP611
Pathway
Translation
PDB homologs
1eg0_N
PDB homologs
1ml5_C
PDB homologs
1giy_C
PDB homologs
1AD2
Pfam
PF00687
PID
g1674313
RefSeq
NP_109908.1
Swiss-Prot protein ID
RL1_MYCPN
phylomeDB tree
RL1_MYCPN
UniProt
P78035
Transcription
IMAGE BROWSERS

OPERON OP93 (Genomic Overview)
Region:265662-273150

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn220STRING legend

PDB image(s)

1eg0

PDB 1eg0

1ml5

PDB 1ml5

1giy

PDB 1giy

1AD2

PDB 1AD2