Gene grpE (MPN120)
Name
grpE
Stable ID
MPN120
Location
155323 - 155976 +
Sequence
    1  ATGAGCGAAA ACTCACTCAC AATTACCGAA ATTCTCAGTT CCATCCGTAC GCTTTTAGTC
   61  AAACACAATA AGGCTAAAGT AACCCAAATT GAAAAGGAAC TTTTACAAGC AGTTGCTGAA
  121  CTGGAAAAGA AGTTTAAGCA ACAAGTACAA AACTTCAACG AGTTGCAACA AAAGATTCCT
  181  AACTTACAAA AAGTCAACGA GGAATTTCGC TTAAAAGTGG AAAAAATCCA GGAAGAAGCG
  241  CAGAAGAAAA TTCAGGAAAA AGTGGCAGAA CTGACCATTA AAAGTAAGGA AGAGTTGGAA
  301  AATGCAAAGA AGTATGTGAT CGAAAAGTCG ATTGATCAAC CCTTAATTAT TATTGACCAG
  361  TTCGAAATTG CACTTTCCTA TGCTCAAAAG GATCCCCAAG TAAAAAACTA TACCACTGGG
  421  TTTAACATGG TGTTGGATGC CTTTTCGCGC TGATTAGAAG GTTTTGGTGT TACTAAGATT
  481  GCCATTGAAC CAGGGGCACA ATTTGACGAA AAGGTGATGG CAGCACTGGA AGTTGTGCCT
  541  TCTGATCAAC CGGCTAATAC GGTGGTGAAG GTATCGAAAT CGGGTTACAA ACTCCACGAC
  601  AAGGTCATTC GCTTTGCTTC CGTAGTGGTA AGCCAAGGTA ATAAAACAGA ATAA
Download Sequence
Operon
OP54
Operon location
152540 - 160900
Protein (mpn120)
Name
Heat shock protein GrpE
Stable ID
Mpn120
Molecular Weight
23870
Isoelectric Point
9
Localization
Cytoplasm
Comment The cochaperone GrpE functions as a nucleotide exchange factor to promote dissociation of adenosine 5'-diphosphate (ADP) from the nucleotide-binding cleft of DnaK. GrpE and the DnaJ cochaperone act in concert to control the flux of unfolded polypeptides into and out of the substrate-binding domain of DnaK by regulating the nucleotide-bound state of DnaK. DnaJ stimulates nucleotide hydrolysis, and GrpE promotes the exchange of ADP for adenosine triphosphate (ATP) and also augments peptide release from the DnaK substrate-binding domain in an ATP-independent manner
Sequence
MSENSLTITEILSSIRTLLVKHNKAKVTQIEKELLQAVAELEKKFKQQVQNFNELQQKIPNLQKVNEEFRLKVEKIQEEA
QKKIQEKVAELTIKSKEELENAKKYVIEKSIDQPLIIIDQFEIALSYAQKDPQVKNYTTGFNMVLDAFSRWLEGFGVTKI
AIEPGAQFDEKVMAALEVVPSDQPANTVVKVSKSGYKLHDKVIRFASVVVSQGNKTE
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation NYTTGFNmVLDAFSR 136 151 M
Oxidation NYTTGFNmVLDAFSr 136 151 M
Oxidation VmAALEVVPSDQPANTVVK 172 191 M
Oxidation VmAALEVVPSDQPANTVVk 172 191 M
GENE/PROTEIN grpE (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
50-212 PF01025 (IPR000740) GrpE nucleotide exchange factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006457'>'protein' == '' ? '': 'protein'; 'folding' == '' ? '': 'folding'; ('GO' == '' ? '': 'GO';:0006457) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030150'>'protein' == '' ? '': 'protein'; 'import' == '' ? '': 'import'; 'into' == '' ? '': 'into'; 'mitochondrial' == '' ? '': 'mitochondrial'; 'matrix' == '' ? '': 'matrix'; ('GO' == '' ? '': 'GO';:0030150)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005739'>'mitochondrion' == '' ? '': 'mitochondrion'; ('GO' == '' ? '': 'GO';:0005739)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000774'>'adenyl' == '' ? '': 'adenyl';-'nucleotide' == '' ? '': 'nucleotide'; 'exchange' == '' ? '': 'exchange'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0000774) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0042803'>'protein' == '' ? '': 'protein'; 'homodimerization' == '' ? '': 'homodimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0042803) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0051087'>'chaperone' == '' ? '': 'chaperone'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0051087)

1.4e-33
53-217 PTHR21237 (IPR000740) GrpE nucleotide exchange factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006457'>'protein' == '' ? '': 'protein'; 'folding' == '' ? '': 'folding'; ('GO' == '' ? '': 'GO';:0006457) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030150'>'protein' == '' ? '': 'protein'; 'import' == '' ? '': 'import'; 'into' == '' ? '': 'into'; 'mitochondrial' == '' ? '': 'mitochondrial'; 'matrix' == '' ? '': 'matrix'; ('GO' == '' ? '': 'GO';:0030150)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005739'>'mitochondrion' == '' ? '': 'mitochondrion'; ('GO' == '' ? '': 'GO';:0005739)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000774'>'adenyl' == '' ? '': 'adenyl';-'nucleotide' == '' ? '': 'nucleotide'; 'exchange' == '' ? '': 'exchange'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0000774) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0042803'>'protein' == '' ? '': 'protein'; 'homodimerization' == '' ? '': 'homodimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0042803) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0051087'>'chaperone' == '' ? '': 'chaperone'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0051087)

2.9e-21
53-217 PTHR21237:SF3 (n.a.) NULL 2.9e-21
55-153 G3DSA:3.90.20.20 (IPR013805) GrpE nucleotide exchange factor, coiled-coil Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005515'>'protein' == '' ? '': 'protein'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005515)

0.0000000002
93-109 PR00773 (IPR000740) GrpE nucleotide exchange factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006457'>'protein' == '' ? '': 'protein'; 'folding' == '' ? '': 'folding'; ('GO' == '' ? '': 'GO';:0006457) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030150'>'protein' == '' ? '': 'protein'; 'import' == '' ? '': 'import'; 'into' == '' ? '': 'into'; 'mitochondrial' == '' ? '': 'mitochondrial'; 'matrix' == '' ? '': 'matrix'; ('GO' == '' ? '': 'GO';:0030150)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005739'>'mitochondrion' == '' ? '': 'mitochondrion'; ('GO' == '' ? '': 'GO';:0005739)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000774'>'adenyl' == '' ? '': 'adenyl';-'nucleotide' == '' ? '': 'nucleotide'; 'exchange' == '' ? '': 'exchange'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0000774) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0042803'>'protein' == '' ? '': 'protein'; 'homodimerization' == '' ? '': 'homodimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0042803) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0051087'>'chaperone' == '' ? '': 'chaperone'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0051087)

0.0000024
157-213 G3DSA:2.30.22.10 (IPR009012) GrpE nucleotide exchange factor, head Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006457'>'protein' == '' ? '': 'protein'; 'folding' == '' ? '': 'folding'; ('GO' == '' ? '': 'GO';:0006457)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005515'>'protein' == '' ? '': 'protein'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005515)

0.0000000000000065
158-215 SSF51064 (IPR009012) GrpE nucleotide exchange factor, head Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006457'>'protein' == '' ? '': 'protein'; 'folding' == '' ? '': 'folding'; ('GO' == '' ? '': 'GO';:0006457)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005515'>'protein' == '' ? '': 'protein'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005515)

0.0000000000950001
165-180 PR00773 (IPR000740) GrpE nucleotide exchange factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006457'>'protein' == '' ? '': 'protein'; 'folding' == '' ? '': 'folding'; ('GO' == '' ? '': 'GO';:0006457) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030150'>'protein' == '' ? '': 'protein'; 'import' == '' ? '': 'import'; 'into' == '' ? '': 'into'; 'mitochondrial' == '' ? '': 'mitochondrial'; 'matrix' == '' ? '': 'matrix'; ('GO' == '' ? '': 'GO';:0030150)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005739'>'mitochondrion' == '' ? '': 'mitochondrion'; ('GO' == '' ? '': 'GO';:0005739)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000774'>'adenyl' == '' ? '': 'adenyl';-'nucleotide' == '' ? '': 'nucleotide'; 'exchange' == '' ? '': 'exchange'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0000774) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0042803'>'protein' == '' ? '': 'protein'; 'homodimerization' == '' ? '': 'homodimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0042803) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0051087'>'chaperone' == '' ? '': 'chaperone'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0051087)

0.0000024
168-210 PS01071 (IPR000740) GrpE nucleotide exchange factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006457'>'protein' == '' ? '': 'protein'; 'folding' == '' ? '': 'folding'; ('GO' == '' ? '': 'GO';:0006457) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030150'>'protein' == '' ? '': 'protein'; 'import' == '' ? '': 'import'; 'into' == '' ? '': 'into'; 'mitochondrial' == '' ? '': 'mitochondrial'; 'matrix' == '' ? '': 'matrix'; ('GO' == '' ? '': 'GO';:0030150)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005739'>'mitochondrion' == '' ? '': 'mitochondrion'; ('GO' == '' ? '': 'GO';:0005739)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000774'>'adenyl' == '' ? '': 'adenyl';-'nucleotide' == '' ? '': 'nucleotide'; 'exchange' == '' ? '': 'exchange'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0000774) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0042803'>'protein' == '' ? '': 'protein'; 'homodimerization' == '' ? '': 'homodimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0042803) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0051087'>'chaperone' == '' ? '': 'chaperone'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0051087)

0
191-210 PR00773 (IPR000740) GrpE nucleotide exchange factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006457'>'protein' == '' ? '': 'protein'; 'folding' == '' ? '': 'folding'; ('GO' == '' ? '': 'GO';:0006457) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030150'>'protein' == '' ? '': 'protein'; 'import' == '' ? '': 'import'; 'into' == '' ? '': 'into'; 'mitochondrial' == '' ? '': 'mitochondrial'; 'matrix' == '' ? '': 'matrix'; ('GO' == '' ? '': 'GO';:0030150)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005739'>'mitochondrion' == '' ? '': 'mitochondrion'; ('GO' == '' ? '': 'GO';:0005739)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000774'>'adenyl' == '' ? '': 'adenyl';-'nucleotide' == '' ? '': 'nucleotide'; 'exchange' == '' ? '': 'exchange'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0000774) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0042803'>'protein' == '' ? '': 'protein'; 'homodimerization' == '' ? '': 'homodimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0042803) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0051087'>'chaperone' == '' ? '': 'chaperone'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0051087)

0.0000024
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
131 211 80 - MAG5580 Mycoplasma agalactiae 213 294 0.000000004 31.7073 125
68 214 146 - MARTH_orf619 Mycoplasma arthritidis 127 274 0.0000000000002 30.0654 162
67 216 149 - Caulobacter crescentus NA1000 23 175 0.000000006 30.3226 129
68 212 144 - MCJ_001590 Mycoplasma conjunctivae 90 234 0.000000003 26.8456 126
69 212 143 - MHO_4080 Mycoplasma hominis 117 262 0.0000000000002 28.8591 162
118 212 94 - Lactococcus lactis subsp. lactis KF147 89 179 0.000000004 34.0206 128
94 212 118 - Bacillus subtilis subsp. subtilis 69 187 0.00000005 33.0578 123
94 212 118 - Bacillus subtilis subsp. subtilis 69 187 0.00000005 33.0578 123
83 213 130 - b2614 Escherichia coli 64 195 0.000000002 29.8507 133
1 215 214 - MG201 Mycoplasma genitalium 1 215 <1e-50 73.0233 805
59 212 153 - MCAP_0368 Mycoplasma capricolum subsp. capricolum 50 200 0.00000002 27.2152 119
32 215 183 - MS53_0352 Mycoplasma synoviae 120 296 0.000000003 26.178 126
67 214 147 - MHP7448_0011 Mycoplasma hyopneumoniae 7448 97 244 0.0000000000003 28.1046 160
67 212 145 - MMOB1120 Mycoplasma mobile 97 243 0.0000000000002 28.3784 162
52 212 160 - MSC_0611 Mycoplasma mycoides subsp. mycoides SC 43 200 0.0000000002 28.9157 136
62 213 151 - MYCGA3350 Mycoplasma gallisepticum 61 213 6.99949e-42 50.9804 408
53 212 159 - MYPE8960 Mycoplasma penetrans 71 235 2e-24 37.3494 258
External IDs
COG
COG0576O
Gene ID
877237
GI
13507859
GO
Post-translational modification, protein turnover, chaperones
Home COG
O
InterPro
IPR009012|GrpE nucleotide exchange factor, head
InterPro
IPR013805|GrpE nucleotide exchange factor, coiled-coil
InterPro
IPR000740|GrpE nucleotide exchange factor
Old MP number
MP034
Pathway
Chaperon
PDB homologs
1dkg_A
Pfam
MPN120
PID
g1673682
RefSeq
NP_109808.1
Swiss-Prot protein ID
GRPE_MYCPN
phylomeDB tree No orthologous found
UniProt
P78017
Transcription
IMAGE BROWSERS

OPERON OP54 (Genomic Overview)
Region:152540-160900

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn120STRING legend

PDB image(s)

1dkg

PDB 1dkg