Gene polC (MPN034)
Name
polC
Stable ID
MPN034
Location
36800 - 41131 -
Sequence
    1  ATGGTATTCG ACACCGAAAC CGAAAAGGGT AAACGCATTT GAGCATTATC ACAGTTTTTA
   61  GTTAAGAAAA ATATTCTCGA TCACAACGAA TTGCACCAAC TCAACAACCG GATTGAACTG
  121  GTTTACCTCG AGAATGATCG CGAAAACGCC CTGTTTCTCG TGGCGCTCAC TTTAAAAAAA
  181  CCGTTAACAA TTGACATTTG AAACGCCCTG TATGAGGGCT TTCAGGATGC GGAAGGGGCA
  241  GAACTGAGGA TTACCTTCCA AGAAGATGCC ACCTTCTTTA AGGACGGGTC CACTAAGTCC
  301  AGTGTCACCT TAGCCATTAT CAAAGACTAC TTCAAAAGCT TCTTTGGTAA GGACAAGAAG
  361  TACCGCATCC TGTTAGAGCA AGAGTTAACC CATCCTAACT TCTTGTCCTA CAGTAACCAT
  421  GAACTGAAAG CTAACTGCCA GTCCCAAGAA TTAGACCAAT GGTTAATTGA ACAACGCCAA
  481  GCCTTCATTA AGTGGATGCA CCAAGCTGGG TTTACCCACT TTGGTTTTGT CTCGTTGTTT
  541  AATCCACCAG CGGAAAAACA ACTAAAAGTG AAATCAATGA AGGTATCCAA GTACGACAAG
  601  CAGTTTGAAA CCGAGGTCTT TAGTACGGAA TTTGTCCCCA TTCACAAGAT TAACCAACAA
  661  ATGGATGAGA TCAAACTAAT GGGGCAAATC TTTGAGTTAA AGGACTTTCC TGGGTACAAC
  721  AACCTCCGTA ATACCCTTAA TATTTATGTC ACTGATTTCC AACTAGGTGG TTCGTTAATT
  781  TTGAAGTGGT TTTACAAGGA TCCCAAAACA ATTGAGGGCA TTAAGATTGG TACCTGAGTT
  841  AAGGCCACGG TTAAGGTCGA ACGTGATGCC AAGACCCAAC TACTCCAGGG TATCATTAAG
  901  GAAATTTCCC CGATTGAAAC CCCCGCTTAC TATCGCCGCC CCGATCAGGA CAAACAAAAA
  961  CGGGTCGAAT TAGTTTTCCA CACCAAGATG AGTGCCTTTG ATGGCATTAA CAGTGTCCAG
 1021  GAATACGCCC AGTTTGCCAA AGAACGCGAT TGGAAGACAA TTGCTGTCAC TGACAAGGAC
 1081  AACATTCACA TTTATCCCAC TTTATATGAA GTGGCCAAAA AGTACGGCTT GAAGGCCATT
 1141  TATGGTTTGG AATGTAACCT CATTGATGAT CACATTAAGA TAGTTAGCAA TCCTGATAAA
 1201  ACCAAACTTA AGGATGCGAC CTTTGTCATC TTCGACATTG AAACAACTGG GTTACACGGT
 1261  CGGTATGACT CGGTGATTGA GTTTGCGGGA ATTAAGGTCA AACATAACCG TGAAGTGGAA
 1321  CGAATGCAGT TCTTTCTCAA GATTGATGGA CCCTTACCTG CAGCAGTTAC CGAAATTACC
 1381  AAGATTACCC AAGCACAACT AGAAGATGGG ATGGAACAGC AAGCGGGGTT GGAAAAACTG
 1441  CGCGCTTGAC TAGATGGTTG TGTAATGGTA GCCCATAACG GTTTGAGTTT TGACTTGCCC
 1501  TTTTTACAAA CCCAGTTTGA AAAATACAAC ATTGCGCCAC TAACCAATCC CTTAATTGAT
 1561  ACCTTAGCCT TATCCTGGGC CTTAAATCCC GGGTTTGCCT CCCATACGTT GAGCAATATT
 1621  TGTGCCAAGC TCAAGTTTGA CTTTGATGAT GAACGATTGC ACCGAGCGGA TTATGATACC
 1681  CAGGCCTTAA AAAAGGTCTT TGACTACTTC AAGGAACAGG TCGAACTCAT GGGGATTACT
 1741  AATCTCGAGC AGTTAGACCA AGAGTTAAAC CAGCAGTGCC ACTTTGAACT GCTCAAGCGC
 1801  ACTTTTACCA ATACCGGCAT TATCTACATT AAGAGCCAAA GTGGGTTTGC TAAACTGTAT
 1861  GAACTGTTAT CAATTGCGCT CACCGATAAC AACGCTACTC GACCCCTAGT GTTAACTTCA
 1921  ACACTCCAAA AGTTTGCTAA ATCCTTTGTC ATTACTGATA ACCCGGTGCA AGGTGATATC
 1981  TTTAAAGCGG CATTGACTAA ACCGCTTAAA GAATTAGAAG CGGCCATTAA AAGAGTTGAC
 2041  TTTGTTTTAA TTGCCCCACC TGGTGCTTAT GCTGGTTACA CCATCAGGGA AGGTTTGAAA
 2101  AAAGAAGCCA TTCCTAACGC AATTAAGTTA GTGGTGGACA CGGCCCAAAG ACTCAATAAG
 2161  TTAGTGGCAG TTGCCTCGGA TGCTTACTTT ATTCACCCCT GGGAGAATGA GTACTATAAG
 2221  GCCATAGTTT GTGCCAAGGG TCTGGGTGGG CGTTGACACC GTCACTTTAA CTATAAGGAA
 2281  AGGGAACAAC GGGTTCCCAA TGTGTTTGTG CGTACCACAG GGGAAATGCT CAATGAAATG
 2341  AGTTTTTTAG GCGAACAATT AGCTTACGAG TTAGTGGTCG AAAACACCAA TAAGTTAGCG
 2401  AAACAACTCA CCGCTGATGA CCTGGTACCA GTGCAAACCA AACTCCAACC ACCAGTAATT
 2461  GAAGGTTCTA ACGAAAACCT GGCAGCCAAA ACCTGGAGTC AAGCCAAGGC CATTTACGGT
 2521  GATCCCTTAC CTAAGTTAAT AGAACAACGG ATCCAGGAAG AGTTAAAAGC GATCATTGAC
 2581  AATGGCTTTG GCATTATTTA CTGGATTTCC CATTTACTAG TCAAACAATC GGTTCAAGAT
 2641  GGTTACTTTG TTGGACCGCG GGGTTCAATT GGTTCTTCGT TGGTAGCTAA CCTGATTGGT
 2701  ATCTCGGAAA TTAATCCCTT AGTGCCGCAT TATCTCTGTG AGAGCTGTCA GTACTTTGAG
 2761  GTCAACGAAG AGGTCGATGA TGGGTATGAC CTCATGGTAA GGGATTGTCC AAAGTGTGGT
 2821  GCCAAAGCAG CCTTTAAGGG TGATGGTCAT AACATTCCCT TTGCTACCTT TATGGGTTTT
 2881  GCTGGGGACA AGATTCCCGA TATTGACTTA AACTTTTCCA GTGAGTACCA AGCCAAAGCC
 2941  CATGCTTATG TGAGGGAACT GTTTGGTGAA CAGTACACCT TCCGTGCTGG CACAATTGCG
 3001  ACAGTGGCCG AAAAAACGGC TTACGGGTAT GCGCGCAACT ACTTTGAAAT TATTAAACAA
 3061  ACCGAATTGG CCACCGCTCC CGAAATTGAA CGCTTTAAGC AAAAGTTAGT CGGGATTAAA
 3121  CGCACGACCG GCCAACACCC CGGGGGGATT ATGATCTTCC CCAACCACAA ATCGGTATAT
 3181  GAGTTTACCC CGTGTGGTTA TCCAGCTGAT GATACTTCCA GTGATTGAAA AACGACCCAC
 3241  TTTGAATATG ATGCGTTAGG GAACACCATC TTAAAGTTAG ATATTCTGGG CCAGGATGAT
 3301  CCGACTATGT TAAAGCACCT GGGCGATCTT ACCCATGTCA ATCCACAAAA CATTCCCCGG
 3361  TTTGACAAGA AGCTCACCGA AATGTTTTGG TCGGTCAATC CCTTAAAACT AAAACCGCAC
 3421  TACTTAGATG AACCCACGGG AGCGATTGGG ATTCCCGAGT TTGGTACTAA GTTCGTTCGC
 3481  AAGATCTTGG AACAAACCAA ACCAAAGGGC TTTGGTGACC TCATTCGCGT CTCGGGTCTA
 3541  AGTCACGGGA AGAACGTGTG GGCGGACAAT GCGCAGAAAA TCTTGAAGGA CCAAAACTTA
 3601  AGCTTAAAGG ATGTAATTGC CTGTCGCGAT GACATTATGC TCTACCTCAT TCATAAGGGG
 3661  ATGCAGGCCA AAGATGCTTT TGAGATCATG GAAAAGGTGC GTAAGGGAAT TGCTCTCAAT
 3721  GCCAAGGAAG TGCAGTTAAT GCAGAGCAAT GGGGTCGAAC AACACTGGAT TAATTCGTGT
 3781  TTAAAGATTA GCTACCTGTT CCCGAAAGCC CACGCCGCGG CTTATGTTTT AATGGCCTGA
 3841  CGAATTGCCT GGTTCAAACT GTACCACCCG TTGAGCTACT ATGCTTGTTT GTTGAGCTTT
 3901  AAACTCAAGG AACATGATGT CAGTGGTTTT AAATCAGGTG TGAGCTTTGT CAAGCAAAAA
 3961  CTAGAGGAGC TCAACACACT GTACCGCATT AAACGGATTA AACCCAAAGA AGCAGAACTG
 4021  TTAACCAGTT ACGAGGTTTA TTTAGAGATG ATGGCCCGCG GCATTAAACT AGAACAAATC
 4081  TCTTTAACCC ACTCCCACGC CACTCGTTTT GTCGAGCACA ACGGCATGCT AATTGCCCCT
 4141  TTTATTACGA TTCCGGGGAT GGGGGAAGCT GTGGCCAATT CGATCATAGA AGCGCGTAAC
 4201  GAAAAGCCCT TTAGTTCGCT CGATGACTTT AAAAAACGCA CTAAAATTAC CAAAAAACAC
 4261  ATTGAAGCGT TTACCCAAAT GCAACTACTC GATGAGTTTA GGGAGCAAGA CAACCAGAAA
 4321  AAACTTTTTT AG
Download Sequence
Operon
OP590
Operon location
35800 - 41195
Protein (mpn034)
Name
DNA polymerase III polC-type (PolIII) (EC 2.7.7.7)
Stable ID
Mpn034
Molecular Weight
158730
Isoelectric Point
7
Localization
Cytoplasm
Comment In B. subtilis it works on the leading strand; DNA polymerase III (dnaE) alpha chain; Replicative polymerase with proofreading activity. Contains a zinc-finger like and needs Zn for its activity. Could work on the leading strand mainly.
Sequence
MVFDTETEKGKRIWALSQFLVKKNILDHNELHQLNNRIELVYLENDRENALFLVALTLKKPLTIDIWNALYEGFQDAEGA
ELRITFQEDATFFKDGSTKSSVTLAIIKDYFKSFFGKDKKYRILLEQELTHPNFLSYSNHELKANCQSQELDQWLIEQRQ
AFIKWMHQAGFTHFGFVSLFNPPAEKQLKVKSMKVSKYDKQFETEVFSTEFVPIHKINQQMDEIKLMGQIFELKDFPGYN
NLRNTLNIYVTDFQLGGSLILKWFYKDPKTIEGIKIGTWVKATVKVERDAKTQLLQGIIKEISPIETPAYYRRPDQDKQK
RVELVFHTKMSAFDGINSVQEYAQFAKERDWKTIAVTDKDNIHIYPTLYEVAKKYGLKAIYGLECNLIDDHIKIVSNPDK
TKLKDATFVIFDIETTGLHGRYDSVIEFAGIKVKHNREVERMQFFLKIDGPLPAAVTEITKITQAQLEDGMEQQAGLEKL
RAWLDGCVMVAHNGLSFDLPFLQTQFEKYNIAPLTNPLIDTLALSWALNPGFASHTLSNICAKLKFDFDDERLHRADYDT
QALKKVFDYFKEQVELMGITNLEQLDQELNQQCHFELLKRTFTNTGIIYIKSQSGFAKLYELLSIALTDNNATRPLVLTS
TLQKFAKSFVITDNPVQGDIFKAALTKPLKELEAAIKRVDFVLIAPPGAYAGYTIREGLKKEAIPNAIKLVVDTAQRLNK
LVAVASDAYFIHPWENEYYKAIVCAKGLGGRWHRHFNYKEREQRVPNVFVRTTGEMLNEMSFLGEQLAYELVVENTNKLA
KQLTADDLVPVQTKLQPPVIEGSNENLAAKTWSQAKAIYGDPLPKLIEQRIQEELKAIIDNGFGIIYWISHLLVKQSVQD
GYFVGPRGSIGSSLVANLIGISEINPLVPHYLCESCQYFEVNEEVDDGYDLMVRDCPKCGAKAAFKGDGHNIPFATFMGF
AGDKIPDIDLNFSSEYQAKAHAYVRELFGEQYTFRAGTIATVAEKTAYGYARNYFEIIKQTELATAPEIERFKQKLVGIK
RTTGQHPGGIMIFPNHKSVYEFTPCGYPADDTSSDWKTTHFEYDALGNTILKLDILGQDDPTMLKHLGDLTHVNPQNIPR
FDKKLTEMFWSVNPLKLKPHYLDEPTGAIGIPEFGTKFVRKILEQTKPKGFGDLIRVSGLSHGKNVWADNAQKILKDQNL
SLKDVIACRDDIMLYLIHKGMQAKDAFEIMEKVRKGIALNAKEVQLMQSNGVEQHWINSCLKISYLFPKAHAAAYVLMAW
RIAWFKLYHPLSYYACLLSFKLKEHDVSGFKSGVSFVKQKLEELNTLYRIKRIKPKEAELLTSYEVYLEMMARGIKLEQI
SLTHSHATRFVEHNGMLIAPFITIPGMGEAVANSIIEARNEKPFSSLDDFKKRTKITKKHIEAFTQMQLLDEFREQDNQK
KLF
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mVFDTETEK 1 10 M
Oxidation mVFDTETEKGK 1 12 M
Oxidation mVFDTETEKGKR 1 13 M
Oxidation INQQmDEIK 217 226 M
Oxidation iNQQmDEIK 217 226 M
Oxidation INQQmDEIKLMGQIFELK 217 235 M
Oxidation INQQmDEIKLmGQIFELK 217 235 M
Oxidation INQQMDEIKLmGQIFELK 217 235 M
Oxidation INQQmDEIKLMGQIFELKDFPGYNNLR 217 244 M
Oxidation INQQmDEIKLmGQIFELKDFPGYNNLR 217 244 M
Oxidation INQQMDEIKLmGQIFELKDFPGYNNLR 217 244 M
Oxidation LmGQIFELK 226 235 M
Oxidation LmGQIFELKDFPGYNNLR 226 244 M
Oxidation mSAFDGINSVQEYAQFAK 330 348 M
Oxidation mQFFLK 442 448 M
Oxidation mQFFLKIDGPLPAAVTEITK 442 462 M
Oxidation ITQAQLEDGmEQQAGLEK 462 480 M
Oxidation ITQAQLEDGmEQQAGLEk 462 480 M
Oxidation ITQAQLEDGmEQQAGLEKLR 462 482 M
Oxidation TTGEMLNEmSFLGEQLAYELVVENTNK 772 799 M
Oxidation TTGEmLNEmSFLGEQLAYELVVENTNK 772 799 M
Oxidation TTGEmLNEMSFLGEQLAYELVVENTNK 772 799 M
Oxidation TTGEmLNEmSFLGEQLAYELVVENTNKLAK 772 802 M
Oxidation TTGEmLNEMSFLGEQLAYELVVENTNKLAK 772 802 M
Oxidation AAFKGDGHNIPFATFmGFAGDKIPDIDLNFSSEYQAK 943 980 M
Oxidation TTGQHPGGImIFPNHK 1042 1058 M
Oxidation LDILGQDDPTmLK 1093 1106 M
Oxidation FDKKLTEmFWSVNPLK 1121 1137 M
Oxidation KLTEmFWSVNPLK 1124 1137 M
Oxidation LTEmFWSVNPLK 1125 1137 M
Oxidation DAFEImEK 1225 1233 M
Oxidation AHAAAYVLmAWR 1270 1282 M
Oxidation EAELLTSYEVYLEMmAR 1337 1354 M
Oxidation EAELLTSYEVYLEmmAR 1337 1354 M
Oxidation EAELLTSYEVYLEmMAR 1337 1354 M
Oxidation FVEHNGMLIAPFITIPGmGEAVANSIIEAR 1370 1400 M
Oxidation FVEHNGmLIAPFITIPGmGEAVANSIIEAR 1370 1400 M
Oxidation FVEHNGmLIAPFITIPGMGEAVANSIIEAR 1370 1400 M
Oxidation KHIEAFTQmQLLDEFR 1419 1435 M
Oxidation KHIEAFTQmQLLDEFREQDNQK 1419 1441 M
Oxidation HIEAFTQmQLLDEFR 1420 1435 M
Oxidation HIEAFTQmQLLDEFREQDNQK 1420 1441 M
Oxidation HIEAFTQmQLLDEFREQDNQKK 1420 1442 M
GENE/PROTEIN polC (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
215-1442 TIGR01405 (IPR006308) DNA polymerase III, alpha subunit, Gram-positive t Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005737'>'cytoplasm' == '' ? '': 'cytoplasm'; ('GO' == '' ? '': 'GO';:0005737)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003887'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'DNA' == '' ? '': 'DNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003887)

0
320-408 G3DSA:3.20.20.140 (n.a.) NULL 9.5e-22
322-389 SM00481 (IPR003141) Polymerase/histidinol phosphatase, N-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003887'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'DNA' == '' ? '': 'DNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003887)

7.00001e-21
322-702 PF02811 (IPR004013) PHP, C-terminal Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

2.29953e-42
400-620 TIGR00573 (IPR006054) DNA polymerase III, epsilon subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003887'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'DNA' == '' ? '': 'DNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003887)

0.00025
406-884 SSF53098 (IPR012337) Ribonuclease H-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003676'>'nucleic' == '' ? '': 'nucleic'; 'acid' == '' ? '': 'acid'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003676)

0
407-576 SM00479 (IPR006055) Exonuclease Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005622'>'intracellular' == '' ? '': 'intracellular'; ('GO' == '' ? '': 'GO';:0005622)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004527'>'exonuclease' == '' ? '': 'exonuclease'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004527)

0
408-567 PF00929 (IPR013520) Exonuclease, RNase T/DNA polymerase III 1.1e-30
409-579 G3DSA:3.30.420.10 (n.a.) NULL 1.79366e-43
658-794 G3DSA:3.20.20.140 (n.a.) NULL 9.5e-22
826-1237 PF07733 (IPR011708) Bacterial DNA polymerase III, alpha subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005737'>'cytoplasm' == '' ? '': 'cytoplasm'; ('GO' == '' ? '': 'GO';:0005737)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008408'>3'-5' 'exonuclease' == '' ? '': 'exonuclease'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0008408)

0
1339-1426 G3DSA:1.10.150.280 (n.a.) NULL 8.4e-17
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
316 1437 1121 - MAG0650 Mycoplasma agalactiae 332 1454 <1e-50 37.8828 1993
884 1299 415 - MARTH_orf612 Mycoplasma arthritidis 307 729 0.000000005 20.2062 132
217 1443 1226 - MARTH_orf732 Mycoplasma arthritidis 214 1438 <1e-50 38.5358 2061
299 1427 1128 - MCJ_007160 Mycoplasma conjunctivae 289 1438 <1e-50 37.943 2022
848 1438 590 - MHO_4120 Mycoplasma hominis 269 835 0.000000000000004 21.3433 184
218 1443 1225 - MHO_4630 Mycoplasma hominis 215 1437 <1e-50 37.8117 2062
408 549 141 - Lactococcus lactis subsp. lactis KF147 7 147 0.000001 25.3521 116
243 1443 1200 - Lactococcus lactis subsp. lactis KF147 426 1634 <1e-50 37.2245 2075
848 1304 456 - Lactococcus lactis subsp. lactis KF147 281 738 0.0000000000003 22.8457 172
408 571 163 - Lactococcus lactis subsp. lactis KF147 5 167 0.0000001 29.7619 124
812 1433 621 - Bacillus subtilis subsp. subtilis 265 858 0.00000000000002 20.7439 187
408 567 159 - Bacillus subtilis subsp. subtilis 10 167 0.00000000000001 29.1925 188
214 1443 1229 - Bacillus subtilis subsp. subtilis 235 1447 <1e-50 38.5542 2247
214 1443 1229 - Bacillus subtilis subsp. subtilis 225 1437 <1e-50 38.5542 2245
408 567 159 - Bacillus subtilis subsp. subtilis 6 163 0.00000000000002 29.1925 188
812 1433 621 - Bacillus subtilis subsp. subtilis 265 858 0.00000000000002 20.7439 187
848 1418 570 - b0184 Escherichia coli 322 873 0.00000000000004 21.3396 182
1 1440 1439 - MG031 Mycoplasma genitalium 1 1448 <1e-50 72.6708 5752
224 1437 1213 - Mycoplasma pulmonis 215 1430 <1e-50 37.1151 2028
274 1433 1159 - MCAP_0339 Mycoplasma capricolum subsp. capricolum 291 1469 <1e-50 40.3376 2244
195 1443 1248 - MS53_0004 Mycoplasma synoviae 180 1450 <1e-50 34.9884 1982
850 1437 587 - MHP7448_0582 Mycoplasma hyopneumoniae 7448 261 827 0.0000001 20.3822 121
257 1432 1175 - MHP7448_0532 Mycoplasma hyopneumoniae 7448 240 1458 <1e-50 37.2453 2048
315 1443 1128 - MMOB0570 Mycoplasma mobile 306 1433 <1e-50 38.8938 2099
313 1433 1120 - MSC_0355 Mycoplasma mycoides subsp. mycoides SC 332 1472 <1e-50 40.9408 2253
54 1437 1383 - MYCGA0940 Mycoplasma gallisepticum 47 1489 <1e-50 35.4773 2219
404 575 171 - MYPE9530 Mycoplasma penetrans 6 172 0.0000008 23.2044 115
249 1443 1194 - MYPE9170 Mycoplasma penetrans 259 1456 <1e-50 43.0464 2602
400 566 166 - MYPE1270 Mycoplasma penetrans 3 168 0.00000000003 28.655 153
848 1433 585 - Mycoplasma pulmonis 253 808 0.000000000001 21.2257 165
External IDs
Transcription
IMAGE BROWSERS

OPERON OP590 (Genomic Overview)
Region:35800-41195

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn034STRING legend

PDB image(s)

1j54

PDB 1j54

1j53

PDB 1j53

1fxx

PDB 1fxx