Gene atpA (MPN600)
Name
atpA
Stable ID
MPN600
Location
721814 - 723370 -
Sequence
    1  ATGGCAGACA AATTAAATGA ATATGTAGCA CTCATTAAAA ATGAGATTAA GAAGTATTCC
   61  AAACAGATCT TTAACAGTGA AATTGGCAAG GTTATTAGTG TCGCTGATGG CATTGCTAAG
  121  GTCAGTGGTT TGGAAAACGC ACTCTTAAAC GAGTTAATTG AGTTTGAAAA CAACGTGCAG
  181  GGGATTGCGC TTAACCTAGA GCAAAACACG GTTGGGGTGG CGTTGTTTGG TGATTACTCT
  241  AAAATCCGTG AAGGTAGTAC GGCTAAACGG ACCCACAACG TGATGCAAAC TCCCGTGGGT
  301  GATGTAATGT TGGGCCGGAT TGTCAATGCC CTGGGAGAAC CGGTGGATGG TCGTGGTCCG
  361  ATTAAGGCTG AAGAGTTTGA CCAAGTGGAG AAGATTGCCC CTGGGGTAAT GACCCGCAAA
  421  ACCGTTAACC AACCACTGGA AACTGGAATC TTGACGATTG ATGCGTTGTT TCCGATTGGT
  481  AAGGGACAAC GGGAGTTAAT TGTGGGGGAC CGCCAAACTG GTAAGACCTC AATTGCAATT
  541  GACACCATTA TTAACCAACG TGGTAAGGAC GTGTACTGTG TCTATGTAGC GATGGGACAA
  601  AAGAATTCCT CGGTAGCGCA AATTGTCCAC CAGTTAGAGG TAACTGATTC GATGAAGTAC
  661  ACCACGGTGG TGTGTGCTAC AGCCAGTGAT CCCGCTTCGA TGATCTACCT CACGCCCTTT
  721  ACTGGCATTA CCATTGCTGA GTACTGGCTC AAACAGGGTA AGGATGTTCT AATTGTGTTT
  781  GATGATTTGT CCAAGCACGC GATTGCTTAC CGTACCTTAT CCTTACTGTT ACGCCGACCA
  841  CCAGGACGGG AAGCCTTTCC TGGGGATGTG TTCTACTTGC ACTCGCGTTT ACTGGAACGT
  901  GCTTGCCGTT TAAACGAGGA GCATGGTGGT GGCTCGATTA CCGCTTTACC TATTATTGAA
  961  ACGCAAGCTG GGGACATTTC CGCTTACATT CCGACCAACG TCATTTCGAT TACCGATGGT
 1021  CAACTGTTCA TGGTGTCAAA CCTGTTTAAC TCCGGTCAAC GCCCTGCCAT CCACGTGGGG
 1081  TTATCGGTGT CGCGGGTTGG TAGTGCAGCG CAAATTAAAG CAATTAAACA ACAAACCGGG
 1141  AGCTTAAAGT TAGAGCTAGC GCAGTACAGT GAATTAGACA GCTTTAGTCA GTTTGGTAGT
 1201  GACTTGGACG AAAATACCAA GCAAATCTTG GAACGCGGTA AGCGGGTAAT GGAGATGATT
 1261  AAACAACCCA ACGGTAAACC TTACTCACAA ACCCATGAAG CGTTATTCTT GTTTGCGATT
 1321  GCCAAGTCCT TCATTAAGTT TATTCCACTG GATTACATTG CTAAATTTAA GCAACGCATT
 1381  ATGGAGGAAT TTGACAAGGA ACACCCGATT TACAAGGAAA TAGCGACCCA AAAGAGCTTT
 1441  AGTGAAGCGT TGGAAGCACA AACTAACACT GCTTTTAAGG CACTAGTAAA ACGCTTTGTT
 1501  AGTGCTTTAC CAGATTACGA CATCACTAAA TACGGAACGA TGGAGGAGTT GGAATAA
Download Sequence
Operon
OP334
Operon location
719200 - 727573
Protein (mpn600)
Name
ATP synthase subunit alpha (EC 3.6.3.14) (F-ATPase subunit alpha) (ATP synthase F1 sector subunit alpha)
Stable ID
Mpn600
Molecular Weight
56980
Isoelectric Point
7
Localization
Cytoplasm
Comment -
Sequence
MADKLNEYVALIKNEIKKYSKQIFNSEIGKVISVADGIAKVSGLENALLNELIEFENNVQGIALNLEQNTVGVALFGDYS
KIREGSTAKRTHNVMQTPVGDVMLGRIVNALGEPVDGRGPIKAEEFDQVEKIAPGVMTRKTVNQPLETGILTIDALFPIG
KGQRELIVGDRQTGKTSIAIDTIINQRGKDVYCVYVAMGQKNSSVAQIVHQLEVTDSMKYTTVVCATASDPASMIYLTPF
TGITIAEYWLKQGKDVLIVFDDLSKHAIAYRTLSLLLRRPPGREAFPGDVFYLHSRLLERACRLNEEHGGGSITALPIIE
TQAGDISAYIPTNVISITDGQLFMVSNLFNSGQRPAIHVGLSVSRVGSAAQIKAIKQQTGSLKLELAQYSELDSFSQFGS
DLDENTKQILERGKRVMEMIKQPNGKPYSQTHEALFLFAIAKSFIKFIPLDYIAKFKQRIMEEFDKEHPIYKEIATQKSF
SEALEAQTNTAFKALVKRFVSALPDYDITKYGTMEELE
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation RTHNVmQTPVGDVMLGR 90 107 M
Oxidation RTHNVMQTPVGDVmLGR 90 107 M
Oxidation THNVmQTPVGDVMLGr 91 107 M
Oxidation THNVmQTPVGDVMLGR 91 107 M
Oxidation THNVMQTPVGDVmLGR 91 107 M
Oxidation THNVmQTPVGDVmLGR 91 107 M
Oxidation IAPGVmTR 132 140 M
Oxidation IAPGVmTRK 132 141 M
Oxidation GKDVYcVYVAmGQK 188 202 M
Oxidation ImEEFDkEHPIYk 460 473 M
Oxidation ImEEFDKEHPIYK 460 473 M
Oxidation ImEEFDKEHPIYKEIATQK 460 479 M
Oxidation RFVSALPDYDITKYGTmEELE 498 519 M
Oxidation FVSALPDYDITKYGTmEELE 499 519 M
GENE/PROTEIN atpA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
2-501 TIGR00962 (IPR005294) ATPase, F1 complex, alpha subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015986'>'ATP' == '' ? '': 'ATP'; 'synthesis' == '' ? '': 'synthesis'; 'coupled' == '' ? '': 'coupled'; 'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015986)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'complex' == '' ? '': 'complex';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'hydrogen' == '' ? '': 'hydrogen'; 'ion' == '' ? '': 'ion'; 'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'activity' == '' ? '': 'activity'; <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity';

0
9-94 SSF50615 (IPR018118) ATPase, F1/A1 complex, alpha/beta subunit, N-termi Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015992'>'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015992) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046034'>'ATP' == '' ? '': 'ATP'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0046034)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016469'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'two' == '' ? '': 'two';-'sector' == '' ? '': 'sector'; 'ATPase' == '' ? '': 'ATPase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0016469)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'hydrogen' == '' ? '': 'hydrogen'; 'ion' == '' ? '': 'ion'; 'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'activity' == '' ? '': 'activity'; <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity';

1.7e-28
26-91 PF02874 (IPR004100) ATPase, F1/V1/A1 complex, alpha/beta subunit, N-te Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015992'>'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015992) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046034'>'ATP' == '' ? '': 'ATP'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0046034)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016469'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'two' == '' ? '': 'two';-'sector' == '' ? '': 'sector'; 'ATPase' == '' ? '': 'ATPase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0016469)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'hydrogen' == '' ? '': 'hydrogen'; 'ion' == '' ? '': 'ion'; 'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'activity' == '' ? '': 'activity'; <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity';

0.00000000000011
26-92 G3DSA:2.40.30.20 (n.a.) NULL 3.3e-26
95-371 G3DSA:3.40.50.300 (n.a.) NULL 0
95-371 SSF52540 (n.a.) NULL 0
148-364 PF00006 (IPR000194) ATPase, alpha/beta subunit, nucleotide-binding dom Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
194-499 PTHR15184:SF3 (IPR017458) ATPase, F1 complex, alpha subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015986'>'ATP' == '' ? '': 'ATP'; 'synthesis' == '' ? '': 'synthesis'; 'coupled' == '' ? '': 'coupled'; 'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015986)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'complex' == '' ? '': 'complex';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'hydrogen' == '' ? '': 'hydrogen'; 'ion' == '' ? '': 'ion'; 'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'activity' == '' ? '': 'activity'; <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity';

0
194-499 PTHR15184 (n.a.) NULL 0
355-364 PS00152 (IPR020003) ATPase, alpha/beta subunit, nucleotide-binding dom Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
372-499 G3DSA:1.20.150.20 (n.a.) NULL 4.8e-37
372-501 SSF47917 (IPR000793) ATPase, F1/V1/A1 complex, alpha/beta subunit, C-te Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015986'>'ATP' == '' ? '': 'ATP'; 'synthesis' == '' ? '': 'synthesis'; 'coupled' == '' ? '': 'coupled'; 'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015986)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'two' == '' ? '': 'two';-'sector' == '' ? '': 'sector'; 'ATPase' == '' ? '': 'ATPase'; 'complex' == '' ? '': 'complex';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'hydrolase' == '' ? '': 'hydrolase';'>'hydrolase' == '' ? '': 'hydrolase'; 'activity' == '' ? '': 'activity';

3.4e-36
376-463 PF00306 (IPR000793) ATPase, F1/V1/A1 complex, alpha/beta subunit, C-te Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015986'>'ATP' == '' ? '': 'ATP'; 'synthesis' == '' ? '': 'synthesis'; 'coupled' == '' ? '': 'coupled'; 'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015986)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'two' == '' ? '': 'two';-'sector' == '' ? '': 'sector'; 'ATPase' == '' ? '': 'ATPase'; 'complex' == '' ? '': 'complex';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'hydrolase' == '' ? '': 'hydrolase';'>'hydrolase' == '' ? '': 'hydrolase'; 'activity' == '' ? '': 'activity';

0.00000000000019
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
128 491 363 - MAG2930 Mycoplasma agalactiae 126 494 <1e-50 38.7701 615
146 356 210 - MAG2940 Mycoplasma agalactiae 123 332 0.00000000003 25.5708 147
1 506 505 - MAG3540 Mycoplasma agalactiae 1 510 <1e-50 53.7255 1484
26 427 401 - MAG3560 Mycoplasma agalactiae 15 429 5e-24 25.7143 258
1 515 514 - MARTH_orf046 Mycoplasma arthritidis 1 516 <1e-50 55.9846 1546
57 423 366 - MARTH_orf048 Mycoplasma arthritidis 85 439 4e-25 26.738 267
91 344 253 - MARTH_orf256 Mycoplasma arthritidis 69 321 0.00000000000001 26.616 177
104 430 326 - MARTH_orf258 Mycoplasma arthritidis 86 412 <1e-50 42.7711 646
98 327 229 - MARTH_orf498 Mycoplasma arthritidis 76 302 0.000000000003 26.7782 156
132 437 305 - MARTH_orf499 Mycoplasma arthritidis 126 424 <1e-50 43.7908 569
104 400 296 - Caulobacter crescentus NA1000 98 396 6e-21 25.9868 237
28 465 437 - Caulobacter crescentus NA1000 71 512 3e-23 25.2137 256
7 499 492 - Caulobacter crescentus NA1000 7 509 <1e-50 50.8946 1374
105 429 324 - MCJ_003460 Mycoplasma conjunctivae 88 403 <1e-50 41.5385 626
66 450 384 - MCJ_003470 Mycoplasma conjunctivae 46 421 0.0000000000002 24.3309 166
51 423 372 - MCJ_006460 Mycoplasma conjunctivae 34 411 5e-22 24.8062 240
10 502 492 - MCJ_006480 Mycoplasma conjunctivae 8 502 <1e-50 54.7475 1444
1 517 516 - MHO_0240 Mycoplasma hominis 1 520 <1e-50 57.4427 1549
57 423 366 - MHO_0260 Mycoplasma hominis 79 433 2e-25 26.2032 269
91 344 253 - MHO_3120 Mycoplasma hominis 68 318 0.0000000004 23.5741 136
132 484 352 - MHO_3130 Mycoplasma hominis 119 482 <1e-50 39.5161 559
28 466 438 - Lactococcus lactis subsp. lactis KF147 10 445 5e-21 25 235
1 495 494 - Lactococcus lactis subsp. lactis KF147 1 494 <1e-50 53.4274 1360
1 468 467 - Bacillus subtilis subsp. subtilis 1 468 <1e-50 56.6239 1419
62 422 360 - Bacillus subtilis subsp. subtilis 50 412 3e-23 27.1003 258
78 411 333 - Bacillus subtilis subsp. subtilis 63 390 2e-32 28.1437 338
78 411 333 - Bacillus subtilis subsp. subtilis 63 390 2e-32 28.1437 338
62 422 360 - Bacillus subtilis subsp. subtilis 50 412 1e-23 27.3713 262
1 468 467 - Bacillus subtilis subsp. subtilis 1 468 <1e-50 56.6239 1421
6 494 488 - b3734 Escherichia coli 6 509 <1e-50 47.8175 1292
29 465 436 - b3732 Escherichia coli 4 437 1e-28 25.2747 303
1 518 517 - MYCGA3040 Mycoplasma gallisepticum 1 518 <1e-50 63.7765 1790
91 423 332 - MYCGA3060 Mycoplasma gallisepticum 77 411 2e-22 25.9587 244
95 423 328 - MG399 Mycoplasma genitalium 83 412 1e-21 25.9701 237
1 517 516 - MG401 Mycoplasma genitalium 1 517 <1e-50 86.4604 2439
96 405 309 - b1941 Escherichia coli 109 401 4e-21 26.6881 238
12 505 493 - Rv1308 Mycobacterium tuberculosis 15 522 <1e-50 48.2283 1303
29 422 393 - Rv1310 Mycobacterium tuberculosis 28 425 1e-16 23.7624 199
122 321 199 - Rv1297 Mycobacterium tuberculosis 307 498 0.00000001 29.1866 131
146 327 181 - MCAP_0359 Mycoplasma capricolum subsp. capricolum 123 303 0.000000003 25.2632 131
128 416 288 - MCAP_0358 Mycoplasma capricolum subsp. capricolum 117 400 <1e-50 44.9827 633
13 422 409 - MCAP_0084 Mycoplasma capricolum subsp. capricolum 5 416 4e-27 26.7139 285
1 518 517 - MCAP_0082 Mycoplasma capricolum subsp. capricolum 1 521 <1e-50 54.8944 1557
33 430 397 - MS53_0465 Mycoplasma synoviae 9 410 <1e-50 35.8722 627
29 327 298 - MS53_0464 Mycoplasma synoviae 3 302 0.00000000002 23.0769 149
1 516 515 - MS53_0407 Mycoplasma synoviae 1 519 <1e-50 58.3815 1628
28 423 395 - MS53_0405 Mycoplasma synoviae 13 409 4e-25 26.0546 266
85 433 348 - MS53_0160 Mycoplasma synoviae 63 411 0.0000000006 23.2877 136
144 437 293 - MS53_0159 Mycoplasma synoviae 126 416 <1e-50 42.2819 598
30 518 488 - MHP7448_0479 Mycoplasma hyopneumoniae 7448 4 486 <1e-50 33.3333 624
39 423 384 - MHP7448_0053 Mycoplasma hyopneumoniae 7448 29 409 5e-22 25.4408 240
10 485 475 - MHP7448_0051 Mycoplasma hyopneumoniae 7448 9 483 <1e-50 56.9328 1426
33 431 398 - MMOB2970 Mycoplasma mobile 7 410 <1e-50 36.8293 629
94 422 328 - MMOB2960 Mycoplasma mobile 74 404 3e-16 24.4898 191
1 500 499 - MMOB2110 Mycoplasma mobile 1 502 <1e-50 56.5737 1507
29 423 394 - MMOB2080 Mycoplasma mobile 5 406 2e-20 24.7549 226
29 423 394 - MMOB1670 Mycoplasma mobile 300 707 2e-16 23.2614 192
30 422 392 - MMOB1660 Mycoplasma mobile 5 401 <1e-50 41.3098 764
1 518 517 - MSC_0887 Mycoplasma mycoides subsp. mycoides SC 1 521 <1e-50 54.1267 1540
25 467 442 - MSC_0885 Mycoplasma mycoides subsp. mycoides SC 12 472 5e-27 25 284
128 506 378 - MSC_0619 Mycoplasma mycoides subsp. mycoides SC 117 481 <1e-50 39.8417 638
29 344 315 - MSC_0618 Mycoplasma mycoides subsp. mycoides SC 3 320 0.0000000002 21.3415 140
146 270 124 - LIC_12636 Leptospira interrogans serovar Copenhage 220 337 0.0000002 34.0909 119
29 366 337 - LIC_11391 Leptospira interrogans serovar Copenhage 30 367 4e-27 26.8222 290
44 465 421 - LIC_11243 Leptospira interrogans serovar Copenhage 18 442 6e-22 25.2796 245
1 482 481 - LIC_11241 Leptospira interrogans serovar Copenhage 5 488 <1e-50 52.2727 1395
82 344 262 - MYCGA6570 Mycoplasma gallisepticum 60 322 0.0000000003 23.1618 139
142 442 300 - MYCGA6560 Mycoplasma gallisepticum 122 415 <1e-50 41.2541 598
22 423 401 - MYPE620 Mycoplasma penetrans 304 702 1e-22 24.7549 248
1 512 511 - MYPE600 Mycoplasma penetrans 1 512 <1e-50 59.7656 1708
30 430 400 - Mycoplasma pulmonis 6 409 <1e-50 36.8039 600
52 469 417 - Mycoplasma pulmonis 31 448 0.0000000000001 22.7679 169
81 366 285 - Mycoplasma pulmonis 59 343 1e-16 28.0405 194
33 441 408 - Mycoplasma pulmonis 10 420 <1e-50 34.9398 666
1 467 466 - Mycoplasma pulmonis 1 467 <1e-50 61.0278 1518
28 458 430 - Mycoplasma pulmonis 13 434 5e-27 26 284
45 368 323 - Mycoplasma pulmonis 231 561 1e-16 24.8538 195
30 461 431 - Mycoplasma pulmonis 6 437 <1e-50 40.6818 796
External IDs
COG
COG0056C
EC number
3.6.3.14
Gene ID
877099
GI
13508339
GO
Energy production and conversion 
Home COG
C
InterPro
IPR004100|ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal
InterPro
IPR000793|ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal
InterPro
IPR000194|ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding
InterPro
IPR005294|ATPase, F1 complex, alpha subunit
Old MP number
MP242
Pathway
Metabolism energy 
PDB homologs
1SKY-B
PDB homologs
1efr_A
PDB homologs
1cow_A
PDB homologs
1bmf_A
Pfam
PF00306
Pfam
PF00006
Pfam
PF09378
Pfam
PF02874
PID
g1673910
RefSeq
NP_110289.1
Swiss-Prot protein ID
ATPA_MYCPN
phylomeDB tree
ATPA_MYCPN
UniProt
Q50329
Transcription
IMAGE BROWSERS

OPERON OP334 (Genomic Overview)
Region:719200-727573

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn600STRING legend

PDB image(s)

1SKY

PDB 1SKY

1efr

PDB 1efr

1cow

PDB 1cow

1bmf

PDB 1bmf