Gene tklB (MPN082)
Name
tklB
Stable ID
MPN082
Location
101985 - 103931 +
Sequence
    1  ATGAAAAACC TGTTTGCTTG CCAACACTTA GCGTTAAGTG CTATTCAACA CGCTAAGGGT
   61  GGTCATGTGG GAATGGCCTT AGGTGCTAGT CCTATTTTGT ACACCTTATG GACTAAACAC
  121  ATCCAGTTTA ACCCTAACTG TCCCAAATGG ATTAACCGGG ACCGTTTAGT GATGAGTGCA
  181  GGTCATGGTA GTATGGCCTT ATACCCGATC TTACACTTTG CGGGGTTAAT TACGAAGCAG
  241  GAAATGCTCC ATCACAAATA CGGGCAAGTC AACACCTCTT CCCATCCCGA GTATGCCCCT
  301  AATAACTTTA TTGATGCGTC CACTGGTCCC TTAGGACAAG GCCTAGGAAT GGCTGTCGGG
  361  ATGGCCTTGA CACAACGGGT ACTAGCAGCT GAATTTAAAG CGTTAAGTCC CAAACTGTTT
  421  GACCACTTTA CCTATGTGGT TGTGGGTGAT GGTGATCTCC AGGAAGGGGT GAGTTATGAG
  481  GTAGCTCACT TAGCAGGGGT CTACCAGTTA AATAAGCTAA TAGTGCTCCA TGATTCCAAC
  541  CGGGTGCAGA TGGACAGTGT CGTGCGTGAT GTGTCCTTGG AAAACCTGCA AACCCGGTTT
  601  ACCAACATGG GGTGAAATTA CCTTGAAACT AGTGATGCAG TTGCAGACAT TGATGCTGCC
  661  ATTAAACAAG CGAAAAAGTC CGATAAGCCG ACCTTCATTG AGGTGCACAC GACAATTGCT
  721  AAAAACACCA CCTTGGAAGA CCAACCCGCT GGTCACTGGT TTATTCCTAC CGACAAGGAC
  781  TTTGCGCGCT TTAACAGCAA CACCAAGACT AACTTTACCC CGTTTGAATA TCCCCAAACG
  841  GTGTATGACT TCTTTCACAA GCAGGTCATA GCACGCCAAG CTAAACCAGT GCAAGCTTAC
  901  AAGGAATTAC TGGAAAAACT AAAGGACAAA CCGCTGTATA CTAAGTTTAT TAATTGAACG
  961  GAAAACGATT ACCAGGCGTT GTACCTCAAC CAGTTAGATG AACGCAAGGT AGCACAAGCC
 1021  AATGCGGCAA CCCGTAACTA CCTCAAGGAC TTTTTAGGCC AAATTAACAA CAGTAATTCC
 1081  AACTTGTACT GTCTCAATGC TGATGTAGCA CGTTCGTGTA ACATTAAGTT AGGTGATGAT
 1141  AATTTACATA CCAATCCGCA TTCGCGCAAC ATTCAGGTGG GTATTCGGGA ATTTGGTATG
 1201  TCCACCATTA TGAACGGGAT GGCACTCCAT GGTGGGGTCA AAGTGATGGG TGGTACCTTC
 1261  CTAGCGTTTG CTGATTATTC CAAACCCGCA ATTCGCTTAG GGGCGTTAAT GAACCTCCCC
 1321  ACCTTTTATG TGTACACCCA TGACTCTTAC CAAGTCGGTG GTGATGGACC AACCCACCAA
 1381  CCGTACGATC AACTCCCGAT GTTAAGGGCC ATTGAAAACG TTCAGGTTTG ACGGCCTTGT
 1441  GATGAAAAGG AAACAGCGGC TGGGGTTAAC TATGGTTTGT TAAGCCAAGA CCAAACTAAC
 1501  GTATTAATTT TGACCCGTCA AGCTTTGCCT TCCCTAGAAC AATCTGATAG TGTACAGACC
 1561  TTGAAAGGGG GCTATATTAT TAGTAATAGA AAACAACCCG ATGTCATTGT GGCCGCTAGT
 1621  GGCAGTGAAG TTCAGCTGGC ATTGCAACTA GAACAAGCTC TAAACGAACA ACAATTAAAG
 1681  ACGCGGGTGG TGTCAGTGCC CAACATTAAC ATGTTGTTAA GTCAACCCCA AAGCTACTTG
 1741  CAACAACTGT TTGATCCTAA CAGTGTTTTA CTCACCTTAG AAGCGAGTGC TAGCATGGAG
 1801  TGGTATGCAC TAGCAAAATA CGTCAAAAAG CACACCCACT TAGGTGCTTT TAGCTTTGGT
 1861  GAGTCCAATG ACGGGCAAGT CGTGTATGAA CACAAGGGCT TTAATGTGAC TAACTTACTC
 1921  AAGTTGATTA AAACTCTAAA GAGTTAA
Download Sequence
Operon
OP31
Operon location
101980 - 107250
Protein (mpn082)
Name
Transketolase (TK) (EC 2.2.1.1)
Stable ID
Mpn082
Molecular Weight
71280
Isoelectric Point
8
Localization
Cytoplasm
Comment Sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-ribose 5-phosphate + D-xylulose 5-phosphate note: Thiamin pyrophosphate cofactor
Sequence
MKNLFACQHLALSAIQHAKGGHVGMALGASPILYTLWTKHIQFNPNCPKWINRDRLVMSAGHGSMALYPILHFAGLITKQ
EMLHHKYGQVNTSSHPEYAPNNFIDASTGPLGQGLGMAVGMALTQRVLAAEFKALSPKLFDHFTYVVVGDGDLQEGVSYE
VAHLAGVYQLNKLIVLHDSNRVQMDSVVRDVSLENLQTRFTNMGWNYLETSDAVADIDAAIKQAKKSDKPTFIEVHTTIA
KNTTLEDQPAGHWFIPTDKDFARFNSNTKTNFTPFEYPQTVYDFFHKQVIARQAKPVQAYKELLEKLKDKPLYTKFINWT
ENDYQALYLNQLDERKVAQANAATRNYLKDFLGQINNSNSNLYCLNADVARSCNIKLGDDNLHTNPHSRNIQVGIREFGM
STIMNGMALHGGVKVMGGTFLAFADYSKPAIRLGALMNLPTFYVYTHDSYQVGGDGPTHQPYDQLPMLRAIENVQVWRPC
DEKETAAGVNYGLLSQDQTNVLILTRQALPSLEQSDSVQTLKGGYIISNRKQPDVIVAASGSEVQLALQLEQALNEQQLK
TRVVSVPNINMLLSQPQSYLQQLFDPNSVLLTLEASASMEWYALAKYVKKHTHLGAFSFGESNDGQVVYEHKGFNVTNLL
KLIKTLKS
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Methylation mkNLFAcQHLALSAIQHAK 1 20 K
Oxidation mKNLFAcQHLALSAIQHAK 1 20 M
Oxidation mkNLFAcQHLALSAIQHAK 1 20 M
Oxidation GGHVGmALGASPILYTLWTK 20 40 M
Oxidation DRLVmSAGHGSmALYPILHFAGLITK 54 80 M
Oxidation DRLVmSAGHGSMALYPILHFAGLITK 54 80 M
Oxidation DRLVMSAGHGSmALYPILHFAGLITK 54 80 M
Oxidation DRLVmSAGHGSmALYPILHFAGLITKQEmLHHK 54 87 M
Oxidation LVmSAGHGSmALYPILHFAGLITK 56 80 M
Oxidation LVmSAGHGSMALYPILHFAGLITK 56 80 M
Oxidation LVMSAGHGSmALYPILHFAGLITK 56 80 M
Oxidation LVmSAGHGSmALYPILHFAGLITKQEmLHHK 56 87 M
Oxidation YGQVNTSSHPEYAPNNFIDASTGPLGQGLGMAVGmALTQR 87 127 M
Oxidation YGQVNTSSHPEYAPNNFIDASTGPLGQGLGmAVGmALTQR 87 127 M
Oxidation LIVLHDSNRVQmDSVVR 173 190 M
Oxidation VQmDSVVr 182 190 M
Oxidation VQmDSVVR 182 190 M
Oxidation VQmDSVVRDVSLENLQTR 182 200 M
Oxidation FTNmGWNYLETSDAVADIDAAIK 200 223 M
Oxidation FTNmGWNYLETSDAVADIDAAIKQAK 200 226 M
Methylation NTTLEDQPAGHWFIPTDkDFAR 242 264 K
Oxidation NIQVGIREFGmSTIMNGmALHGGVK 390 415 M
Oxidation NIQVGIREFGmSTIMNGMALHGGVK 390 415 M
Oxidation NIQVGIREFGMSTImNGMALHGGVK 390 415 M
Oxidation NIQVGIREFGmSTImNGmALHGGVK 390 415 M
Oxidation NIQVGIREFGMSTImNGMALHGGVKVmGGTFLAFADYSKPAIR 390 433 M
Oxidation EFGmSTImNGmALHGGVK 397 415 M
Oxidation EFGmSTIMNGmALHGGVK 397 415 M
Oxidation EFGmSTIMNGMALHGGVK 397 415 M
Oxidation EFGMSTIMNGmALHGGVK 397 415 M
Oxidation VmGGTFLAFADYSKPAIR 415 433 M
Oxidation vmGGTFLAFADYSKPAIR 415 433 M
Oxidation LGALmNLPTFYVYTHDSYQVGGDGPTHQPYDQLPmLR 433 470 M
Oxidation LGALmNLPTFYVYTHDSYQVGGDGPTHQPYDQLPMLR 433 470 M
GENE/PROTEIN tklB (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-648 TIGR00232 (IPR005478) Transketolase, bacterial-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004802'>'transketolase' == '' ? '': 'transketolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004802)

0
6-311 SSF52518 (n.a.) NULL 0
8-309 PF00456 (IPR005474) Transketolase, N-terminal 0
9-308 G3DSA:3.40.50.970 (n.a.) NULL 0
14-642 PTHR11624:SF1 (IPR005478) Transketolase, bacterial-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004802'>'transketolase' == '' ? '': 'transketolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004802)

0
14-642 PTHR11624 (n.a.) NULL 0
320-513 SSF52518 (n.a.) NULL 0
334-517 G3DSA:3.40.50.970 (n.a.) NULL 0
342-510 PF02779 (IPR005475) Transketolase-like, pyrimidine-binding domain 7.3e-35
342-511 SM00861 (IPR005475) Transketolase-like, pyrimidine-binding domain 9.3887e-44
453-469 PS00802 (IPR020826) Transketolase binding site 0
515-648 SSF52922 (IPR009014) Transketolase, C-terminal/Pyruvate-ferredoxin oxid Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008152'>'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0008152)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

2.3e-28
522-646 G3DSA:3.40.50.920 (IPR015941) Transketolase-like, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008152'>'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0008152)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

1.2e-27
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
6 646 640 - b2935 Escherichia coli 10 662 <1e-50 30.9774 810
6 640 634 - b2465 Escherichia coli 9 655 <1e-50 30.9231 771
11 607 596 - MARTH_orf277 Mycoplasma arthritidis 19 583 <1e-50 26.9737 553
2 644 642 - MAG1930 Mycoplasma agalactiae 6 641 <1e-50 35.8578 1045
3 635 632 - MCJ_001100 Mycoplasma conjunctivae 7 627 <1e-50 37.9416 1016
12 646 634 - MCJ_003120 Mycoplasma conjunctivae 16 609 <1e-50 32.3988 881
3 647 644 - MCAP_0610 Mycoplasma capricolum subsp. capricolum 8 655 <1e-50 36.5008 959
10 543 533 - MYCGA0300 Mycoplasma gallisepticum 14 546 <1e-50 32.037 758
1 648 647 - MG066 Mycoplasma genitalium 1 648 <1e-50 67.1296 2389
11 646 635 - MHP7448_0428 Mycoplasma hyopneumoniae 7448 18 613 <1e-50 32.9688 796
27 544 517 - MHO_1770 Mycoplasma hominis 34 519 9e-22 20.983 238
11 646 635 - MMOB5530 Mycoplasma mobile 18 611 <1e-50 33.5938 883
3 643 640 - MSC_0372 Mycoplasma mycoides subsp. mycoides SC 18 660 <1e-50 35.6164 869
10 643 633 - MYPE4510 Mycoplasma penetrans 13 646 <1e-50 42.7002 1334
10 571 561 - MYPE770 Mycoplasma penetrans 27 588 <1e-50 32.7616 748
1 637 636 - Caulobacter crescentus NA1000 24 661 <1e-50 32.5617 780
7 646 639 - Lactococcus lactis subsp. lactis KF147 13 657 <1e-50 33.7386 875
12 256 244 - LIC_10913 Leptospira interrogans serovar Copenhage 33 271 2e-27 30.1205 294
8 210 202 - LIC_12195 Leptospira interrogans serovar Copenhage 9 202 2e-22 31.5534 249
6 641 635 - MS53_0181 Mycoplasma synoviae 13 638 <1e-50 36.7069 1048
10 635 625 - Rv1449c Mycobacterium tuberculosis 33 686 <1e-50 30.5185 713
2 646 644 - Bacillus subtilis subsp. subtilis 7 664 <1e-50 35.3383 944
2 646 644 - Bacillus subtilis subsp. subtilis 7 664 <1e-50 35.0904 942
11 646 635 - Mycoplasma pulmonis 16 612 <1e-50 37.1875 917
External IDs
Alias
tktA
COG
COG0021G
EC number
2.2.1.1
Gene ID
877050
GI
13507821
GO
Carbohydrate transport and metabolism  
Home COG
G
InterPro
IPR001664|Intermediate filament protein
InterPro
IPR005478|Bacterial transketolase
InterPro
IPR009014|Transketolase, C-terminal-like
InterPro
IPR005475|Transketolase, central region
InterPro
IPR005474|Transketolase, N-terminal
Old MP number
MP073
Pathway
Metabolism, energy
Pathway
Pentose phosphate pathway
PDB homologs
1qgd_A
PDB homologs
1itz_A
PDB homologs
1gpu_A
PDB homologs
1AY0-A
Pfam
PF02775
Pfam
PF02779
Pfam
PF00456
PID
g1673726
RefSeq
NP_109770.1
Swiss-Prot protein ID
TKT_MYCPN
phylomeDB tree
TKT_MYCPN
UniProt
P75611
Transcription
IMAGE BROWSERS

OPERON OP31 (Genomic Overview)
Region:101980-107250

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn082STRING legend

PDB image(s)

1qgd

PDB 1qgd

1itz

PDB 1itz

1gpu

PDB 1gpu

1AY0

PDB 1AY0