Gene cpsG (MPN066)
Name
cpsG
Stable ID
MPN066
Location
82081 - 83745 +
Sequence
    1  ATGAACAGTA ACGCATACTT GGAAGCTCAA AGGTGGCTAA GCCATCCGCG GGTAAAACCC
   61  AACTTAAAGG AGGTCATTAC GGCTATGAGT GCTGAGGAAA TCGAGCACTT CTTTAGCTTA
  121  AAGAAACCGA GTTTTGGCAC TGCTGGGGTA CGGGGCAAAA TGGCACCGGG GTACCATGGG
  181  ATGAATGTGT TTTCCTATGC TTACTTAACC CAGGGTTATG TCAACTACAT CCAGTCGTTA
  241  AACCCAACTA AAAAACCATT ACGCTTTTTA GTAGCCAGAG ACACTAGAAA ACACGGGGCA
  301  TTGTTTAATG GCATTGTGTG TGATGTGATT ACCTCTATGG GTCATGTGGT CTATATGTTT
  361  GATAACAATG AACCAACACC AACACCATTA GTATCTTATG TGATTAAGAA GTACCACTTT
  421  GATGGTGGGG TGAATGTCAC TGCTAGTCAT AATCCTAAAA CCGATAATGG CTTTAAGATT
  481  TACGATGGTC ATGGCGCGCA GTTACTAGAC TTCCAAACTG ATCAATTAAT CGCAATGTTA
  541  CCCCCAGTGG TAACAATGTT AGATTTCGAA CCACGTGGTA ACAACGAGCT GTTACACTTT
  601  TTGGATAACG AAGTGGTCTA CAAAAACTAC TTTGATGATC TTAAGGAAAG CCTAGTAGTG
  661  GACAACGACA GCTTTAAAAA CCTCCCGGTG GTCTTTACCG GGTTACATGG TACTTCGGTG
  721  AAGTTGTTAC CAAGGTTTTT AACCTATTTG GGTTACAGCA ACATTATTAG TGTCCAACCA
  781  CAAAACGTGT TTGACGCTAA CTTTGCTAAT GCTGACCACC TCAACCCCGA AAGTAAGGAT
  841  ACCTGAGAGT TAGCGCGACA GTATGCATCC AACACTAAGG CCAAGTTAAT GATGGCAATT
  901  GATCCGGATG CTGATCGCTT TGCGATTGCC GAATGAAATC CGCAAACCCA AGACTGGCAC
  961  TACTTCTCCG GGAACGAGTC AGGAGTTATG GTGGCTTACT ATAAGCTCAA ACACAAGCAG
 1021  TTTAAGCGTC AACCTTACAT TGTAACGACG GTAGTCTCTA CTGATCTAGT GGATAAGATT
 1081  GCCAAGAAGT ACGGGGCTTT TGTCAAGCGC ACAAATGTCG GCTTTAAGTT TATTGGTCAA
 1141  GCTGTTAATC ACTTCTCCAA AGACAATGAA CTAGTAGTGG CCTTTGAAGA AGCGATTGGT
 1201  ATGATGGCTA GTGATGGTTT GAACCGCGAA AAGGATTCCT TTCAAGCAGC GGCCATCATG
 1261  CTTGAAATTG CGCGCTACTG TCATAATAAA GGAATTAGCT TACTAGAGTT CTACCGTGGT
 1321  GAGATCTTCG GTGAATTTGG TGATTACTAT AACTGAACGG TACCACACAC CATTCACGGA
 1381  GTTAACTGGA AGGAAAAAAT GGAACAGGTA TTACACCAGT TAACCACAGC TACCATTAAA
 1441  GAGGTTGTGG GACACAAGAT TACCAAGATT AAAAACTATG TCGACATTAA CCTAGTCGAA
 1501  TATGTCTTGG AAAACGGTAA CTGGATTAAG TTCCGCATTT CCGGTACAGA ACCGAAGTTA
 1561  AAGCTGTACT TTAACCTATC TAACGGTTAC TTAGCAGCTT TAAAACACGA AGCGAAAAAG
 1621  ATGCACGAGT TCCTAGTGCG ATTGCTCAAC CTCGATAAAG CTTAG
Download Sequence
Operon
OP25
Operon location
79008 - 83850
Protein (mpn066)
Name
Phosphomannomutase (PMM) (EC 5.4.2.8)
Stable ID
Mpn066
Molecular Weight
60940
Isoelectric Point
8
Localization
Cytoplasm
Comment Probable phosphoglucomutase (5.4.2.2) and phosphopentomutase (EC 5.4.2.7), DeoB
Sequence
MNSNAYLEAQRWLSHPRVKPNLKEVITAMSAEEIEHFFSLKKPSFGTAGVRGKMAPGYHGMNVFSYAYLTQGYVNYIQSL
NPTKKPLRFLVARDTRKHGALFNGIVCDVITSMGHVVYMFDNNEPTPTPLVSYVIKKYHFDGGVNVTASHNPKTDNGFKI
YDGHGAQLLDFQTDQLIAMLPPVVTMLDFEPRGNNELLHFLDNEVVYKNYFDDLKESLVVDNDSFKNLPVVFTGLHGTSV
KLLPRFLTYLGYSNIISVQPQNVFDANFANADHLNPESKDTWELARQYASNTKAKLMMAIDPDADRFAIAEWNPQTQDWH
YFSGNESGVMVAYYKLKHKQFKRQPYIVTTVVSTDLVDKIAKKYGAFVKRTNVGFKFIGQAVNHFSKDNELVVAFEEAIG
MMASDGLNREKDSFQAAAIMLEIARYCHNKGISLLEFYRGEIFGEFGDYYNWTVPHTIHGVNWKEKMEQVLHQLTTATIK
EVVGHKITKIKNYVDINLVEYVLENGNWIKFRISGTEPKLKLYFNLSNGYLAALKHEAKKMHEFLVRLLNLDKA
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mNSNAYLEAQr 1 12 M
Oxidation mNSNAYLEAQR 1 12 M
Phosphorylation KYHFDGGVNVTAsHNPK 137 154 S
Phosphorylation KYHFDGGVNVtASHNPK 137 154 T
Phosphorylation YHFDGGVNVTAsHNPK 138 154 S
Phosphorylation YHFDGGVNVTAsHNPk 138 154 S
Phosphorylation YHFDGGVNVtASHNPK 138 154 T
Phosphorylation YHFDGGVNVtASHNPk 138 154 T
Oxidation LmmAIDPDADr 296 307 M
Oxidation LmmAIDPDADR 296 307 M
Oxidation LmMAIDPDADR 296 307 M
GENE/PROTEIN cpsG (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
27-234 SSF53738 (IPR016055) Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/I Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

5.60519e-45
41-235 G3DSA:3.40.120.10 (IPR016055) Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/I Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

2.9e-39
43-176 PF02878 (IPR005844) Alpha-D-phosphohexomutase, alpha/beta/alpha domain Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

1.1e-29
106-523 PTHR22573 (n.a.) NULL 0
106-523 PTHR22573:SF2 (n.a.) NULL 0
143-152 PS00710 (IPR016066) Alpha-D-phosphohexomutase, conserved site Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287)

0
207-316 SSF53738 (IPR016055) Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/I Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0.0000000000033
209-310 PF02879 (IPR005845) Alpha-D-phosphohexomutase, alpha/beta/alpha domain Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0.000000000000019
236-305 G3DSA:3.40.120.10 (IPR016055) Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/I Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0.000000063
302-450 SSF53738 (IPR016055) Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/I Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

1.8e-27
306-450 G3DSA:3.40.120.10 (IPR016055) Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/I Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

2e-26
324-433 PF02880 (IPR005846) Alpha-D-phosphohexomutase, alpha/beta/alpha domain Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0.000000000088
448-550 SSF55957 (n.a.) NULL 0.0000000044
495-524 PF00408 (IPR005843) Alpha-D-phosphohexomutase, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'intramolecular' == '' ? '': 'intramolecular'; 'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0.00055
498-543 G3DSA:3.30.310.50 (n.a.) NULL 0.000088
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
40 523 483 - MAG4650 Mycoplasma agalactiae 1 497 <1e-50 28.6837 486
41 522 481 - Caulobacter crescentus NA1000 3 424 0.00000000000002 23.4086 181
44 523 479 - MCJ_003910 Mycoplasma conjunctivae 3 469 7.00649e-44 30.123 429
45 353 308 - Lactococcus lactis subsp. lactis KF147 5 287 0.000000000002 25.9375 161
10 531 521 - Bacillus subtilis subsp. subtilis 8 554 <1e-50 29.2948 597
45 382 337 - Bacillus subtilis subsp. subtilis 5 315 0.00000000001 23.6311 160
10 547 537 - Bacillus subtilis subsp. subtilis 15 584 <1e-50 29.3403 614
45 382 337 - Bacillus subtilis subsp. subtilis 5 315 0.000000000001 23.9193 167
90 378 288 - Rv3441c Mycobacterium tuberculosis 46 314 0.00000000000001 26.0274 182
7 526 519 - MT3407 Mycobacterium tuberculosis 1 504 2e-39 25.3259 397
125 378 253 - b3176 Escherichia coli 78 311 0.00000000001 23.7354 157
7 554 547 - MG053 Mycoplasma genitalium 6 550 <1e-50 61.6364 1783
21 546 525 - MT3153 Mycobacterium tuberculosis 18 546 0.0000005 22.9565 117
12 551 539 - MCAP_0756 Mycoplasma capricolum subsp. capricolum 13 560 <1e-50 30.7554 686
40 524 484 - MMOB2630 Mycoplasma mobile 1 488 4.06377e-44 26.3366 431
11 429 418 - MMOB2020 Mycoplasma mobile 9 419 6e-22 23.0942 240
12 551 539 - MSC_0829 Mycoplasma mycoides subsp. mycoides SC 13 558 <1e-50 30.7414 658
50 546 496 - LIC_11766 Leptospira interrogans serovar Copenhage 1 517 1.4013e-45 28.6792 451
48 522 474 - LIC_10446 Leptospira interrogans serovar Copenhage 18 436 0.00000000003 19.5833 153
12 553 541 - MYCGA5820 Mycoplasma gallisepticum 14 549 <1e-50 41.6514 1085
1 541 540 - MYPE1070 Mycoplasma penetrans 12 552 <1e-50 36.4299 953
External IDs
Alias
deoB
COG
COG1109G
EC number
5.4.2.2
EC number
5.4.2.8
EC number
5.4.2.7
Gene ID
876721
GI
13507805
GO
Carbohydrate transport and metabolism  
Home COG
G
InterPro
IPR005844|Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
InterPro
IPR005845|Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
InterPro
IPR005841|Phosphoglucomutase/phosphomannomutase
Old MP number
MP088
Pathway
Metabolism energy, Sugars
PDB homologs
1c47_A
PDB homologs
1c4g_A
PDB homologs
1lxt_A
PDB homologs
1JDY-A
Pfam
PF02878
Pfam
PF00408
Pfam
PF02879
PID
g1673743
RefSeq
NP_109754.1
Swiss-Prot protein ID
MANB_MYCPN
phylomeDB tree
MANB_MYCPN
UniProt
P75050
Transcription
IMAGE BROWSERS

OPERON OP25 (Genomic Overview)
Region:79008-83850

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn066STRING legend

PDB image(s)

1c47

PDB 1c47

1c4g

PDB 1c4g

1lxt

PDB 1lxt

1JDY

PDB 1JDY