Gene potA (MPN055)
Name
potA
Stable ID
MPN055
Location
70404 - 72086 +
Sequence
    1  TTGAACGAAC GTTTTTTAAT TGAAATCGAA GGTTTAAACA AAACTTTCGA TGATGGTTTT
   61  GTATCAGTAC GTGATATTAA CCTCAAAATT AAGAAGGGCG AATTTATTAC GATTCTCGGT
  121  CCTTCTGGTT GTGGCAAAAC AACTACTCTT AGGTTGTTAG CAGGTTTTGA AGATCCTACT
  181  TATGGCAAGA TCAAAGTTAA TGGTCTTGAC ATTAAAGACT TGCCCATTCA TAAGCGTCCC
  241  TTTGCTACTG TCTTCCAAGA CTATGCCTTG TTTTCACACT TAACTGTGTA CAAGAACATT
  301  GCTTATGGCT TGAAGGCAAT GTACACAAAG CTGGATCCGA TTGATAAGCT AGTGGAACAA
  361  TACCACCAAA GCTTACTGGA CAAGCAACAC CGCTTGCACA AGAGGATTGA ACGCTTAGAA
  421  AAAAGTAATG CTAATCCACA ACTGTTAGAA CAACTTAAAC AAACGGTTGT CGTTCAACAA
  481  AAACAGTTTA AACAACAAAC AGAGACTTTT AAACAAAAGG AAAATGCTCG ACGTGATGCC
  541  ATTCAACAAC GCTTGGTGCA ACTTACCAAG GAATGGGAAA GCTTATCAAA GCAGAAGTTG
  601  CAACAATTAG AAGCGGAGAA AAAGTTGTTA GATAAAAAGT TTGAACAAAC TGAGCGCAAA
  661  TACCAAAAGG ATGCTTGGAT GGCAACCCAC AGTGAAATGC GTTTAAAGCA GTTCAAACAA
  721  GAGGTGTTAG CTTTAAAACA ACTAATTAAA ACTAAGTTCA AACAAAATGA ACCAGTTGAC
  781  AAGTTGCAGT TAAAGCTGCA AACCTTAAAG CAAAAGTATG CTGCTAAAAG ACAAATTGAT
  841  AAGGAATACG ATAAGTTGGT CTTAGCCTAC AACAAGAAGG ACTATTGAAC TTCATACTGG
  901  GAAACCTATT CTTTACAACA ACAAGAAGCC TTTGAAAAGC GTTACTTATC GCGCAAACTC
  961  ACTAAACAAG AACAACACCA AAAGGTGTGT GCTGTAATTG AGTTAGTTGG TTTAAAGGGT
 1021  AACGAGGACA AACTCCCAGA AGAATTGTCT GGGGGAATGA AGCAACGGGT AGCTTTAGCG
 1081  CGTTCCTTGG TAATTGAACC AGACATTCTC TTATTGGATG AACCCTTGTC TGCTTTAGAT
 1141  GCTAAGGTAC GTAAAAACTT GCAAAAGGAA TTGCAAAAGA TTCACCAACA AAGTGGTTTA
 1201  ACCTTTATCT TAGTTACTCA CGACCAGGAA GAAGCCTTGG TCTTGTCAAA CCGCATTGTG
 1261  GTAATGAATG AGGGTAACAT TCTCCAAGTT GGTAGTCCGG CTGATATTTA CGATTCACCC
 1321  AAAACCGAGT GGATTGCTAA CTTCATTGGT CAAGCTAATA TCTTTAAGGG TACTTACCTA
 1381  GGTGACCTTA AGATTAAACT GCACAGCGGT GAAGTGATTA AAACTGATGT GGACAATAAC
 1441  TATGTGGTTG GTAAGGAATA CAAAATCCTA ATTCGTCCCG AAGACTTTGA CATTGTGCCC
 1501  AAAAACAAAG GCTTCTTTAA TGTTCGGGTA ATTGATAAAA CCTACAAAGG ATTACTCTGA
 1561  AAGATTACTA CTAAGTTAGT TGATGACACC ATAGTAGATC TAGAGAGTGT CAACGACATT
 1621  GAGGTTGACA AAACCTTTGG GGTCACCTTT GATCCGATTG ATGTTCACCT AATGGAGGTA
 1681  TAG
Download Sequence
Operon
OP22
Operon location
70382 - 75203
Protein (mpn055)
Name
Spermidine/putrescine import ATP-binding protein potA (EC 3.6.3.31)
Stable ID
Mpn055
Molecular Weight
61600
Isoelectric Point
10
Localization
Cytoplasm
Comment TC 3.A.1.11.1
Sequence
MNERFLIEIEGLNKTFDDGFVSVRDINLKIKKGEFITILGPSGCGKTTTLRLLAGFEDPTYGKIKVNGLDIKDLPIHKRP
FATVFQDYALFSHLTVYKNIAYGLKAMYTKLDPIDKLVEQYHQSLLDKQHRLHKRIERLEKSNANPQLLEQLKQTVVVQQ
KQFKQQTETFKQKENARRDAIQQRLVQLTKEWESLSKQKLQQLEAEKKLLDKKFEQTERKYQKDAWMATHSEMRLKQFKQ
EVLALKQLIKTKFKQNEPVDKLQLKLQTLKQKYAAKRQIDKEYDKLVLAYNKKDYWTSYWETYSLQQQEAFEKRYLSRKL
TKQEQHQKVCAVIELVGLKGNEDKLPEELSGGMKQRVALARSLVIEPDILLLDEPLSALDAKVRKNLQKELQKIHQQSGL
TFILVTHDQEEALVLSNRIVVMNEGNILQVGSPADIYDSPKTEWIANFIGQANIFKGTYLGDLKIKLHSGEVIKTDVDNN
YVVGKEYKILIRPEDFDIVPKNKGFFNVRVIDKTYKGLLWKITTKLVDDTIVDLESVNDIEVDKTFGVTFDPIDVHLMEV

Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation KYQKDAWmATHSEMR 220 235 M
Oxidation DAWMATHSEmR 224 235 M
Oxidation DAWmATHSEmR 224 235 M
Methylation LVLAYNk 286 293 K
Oxidation VcAVIELVGLKGNEDKLPEELSGGmK 329 355 M
Oxidation GNEDKLPEELSGGmK 340 355 M
Oxidation IVVmNEGNILQVGSPADIYDSPK 419 442 M
Oxidation TFGVTFDPIDVHLmEV 545 561 M
GENE/PROTEIN potA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
6-103 G3DSA:3.40.50.300 (n.a.) NULL 0
6-449 SSF52540 (n.a.) NULL 0
6-560 PS51305 (IPR017879) Spermidine/putrescine import ATP-binding protein, 0
7-449 PS50893 (IPR003439) ABC transporter-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

0
7-458 PTHR19222:SF43 (n.a.) NULL 0
7-458 PTHR19222 (n.a.) NULL 0
32-223 SSF52540 (n.a.) NULL 0.00000081
32-426 SM00382 (IPR003593) ATPase, AAA+ type, core Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000166'>'nucleotide' == '' ? '': 'nucleotide'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000166) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0017111'>'nucleoside' == '' ? '': 'nucleoside';-'triphosphatase' == '' ? '': 'triphosphatase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0017111)

3.5e-16
47-376 PF00005 (IPR003439) ABC transporter-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

0.000000000000073
315-445 G3DSA:3.40.50.300 (n.a.) NULL 0
349-363 PS00211 (IPR017871) ABC transporter, conserved site Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

0
451-560 SSF50331 (IPR008995) Molybdate/tungstate binding Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006810'>'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0006810)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0043190'>'ATP' == '' ? '': 'ATP';-'binding' == '' ? '': 'binding'; 'cassette' == '' ? '': 'cassette'; ('ABC' == '' ? '': 'ABC';) 'transporter' == '' ? '': 'transporter'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0043190)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005215'>'transporter' == '' ? '': 'transporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005215) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'hydrolase' == '' ? '': 'hydrolase';'>'hydrolase' == '' ? '': 'hydrolase'; 'activity' == '' ? '': 'activity';

0.00000000024
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
1 108 107 - MAG0140 Mycoplasma agalactiae 1 110 0.000000008 29.5652 127
322 434 112 - MAG0140 Mycoplasma agalactiae 398 508 0.00000003 27.4336 127
6 70 64 - MAG0140 Mycoplasma agalactiae 263 327 0.000005 35.3846 127
344 436 92 - MAG0290 Mycoplasma agalactiae 108 199 0.00000009 31.1828 118
26 85 59 - MAG0290 Mycoplasma agalactiae 1 64 0.0000004 37.5 118
312 440 128 - MAG0340 Mycoplasma agalactiae 244 373 4e-16 30.7692 190
6 66 60 - MAG0340 Mycoplasma agalactiae 37 100 0.0000001 37.5 190
321 436 115 - MAG0350 Mycoplasma agalactiae 217 335 0.0000000000005 31.0924 163
288 440 152 - MAG1030 Mycoplasma agalactiae 125 282 0.000000000000008 28.481 178
311 449 138 - MAG1040 Mycoplasma agalactiae 585 724 0.000000000000005 25.7143 180
291 558 267 - MAG1250 Mycoplasma agalactiae 173 455 <1e-50 43.662 546
5 104 99 - MAG1250 Mycoplasma agalactiae 10 108 7e-30 59 546
349 442 93 - MAG1630 Mycoplasma agalactiae 128 221 0.00000001 35.1064 126
348 487 139 - MAG2310 Mycoplasma agalactiae 210 351 4e-24 38.7324 259
23 71 48 - MAG2700 Mycoplasma agalactiae 22 70 0.000002 36.7347 106
348 408 60 - MAG2700 Mycoplasma agalactiae 203 262 0.000008 42.623 106
347 439 92 - MAG3110 Mycoplasma agalactiae 492 580 0.00000001 29.0323 126
320 432 112 - MAG4610 Mycoplasma agalactiae 106 218 0.0000000006 26.5487 136
6 98 92 - MAG4610 Mycoplasma agalactiae 4 95 0.000004 27.957 136
344 498 154 - MAG5050 Mycoplasma agalactiae 470 623 4e-30 42.4051 310
21 105 84 - MAG5050 Mycoplasma agalactiae 59 143 8e-19 44.7059 310
304 447 143 - MAG5170 Mycoplasma agalactiae 122 261 3e-16 35.1724 191
336 439 103 - MAG5180 Mycoplasma agalactiae 124 226 0.000000000000001 36.5385 186
22 105 83 - MAG5180 Mycoplasma agalactiae 18 104 0.000003 29.8851 186
6 66 60 - MAG5960 Mycoplasma agalactiae 1 60 0.000004 36.0656 103
23 75 52 - MAG5990 Mycoplasma agalactiae 388 440 0.00000002 41.5094 123
347 437 90 - MAG6000 Mycoplasma agalactiae 491 584 0.000006 27.8351 102
344 430 86 - MAG7430 Mycoplasma agalactiae 254 339 0.0000000001 35.6322 142
5 100 95 - MAG7430 Mycoplasma agalactiae 119 223 0.00000001 28.5714 142
23 71 48 - Lactococcus lactis subsp. lactis KF147 32 80 0.0000006 44.898 148
299 436 137 - Lactococcus lactis subsp. lactis KF147 102 236 0.00000000007 30.2158 148
23 104 81 - Lactococcus lactis subsp. lactis KF147 28 106 0.000000000000001 42.6829 241
319 430 111 - Lactococcus lactis subsp. lactis KF147 111 227 1e-21 43.5897 241
6 104 98 - Lactococcus lactis subsp. lactis KF147 4 101 1e-23 48.4848 399
318 552 234 - Lactococcus lactis subsp. lactis KF147 104 341 5e-40 39.5062 399
323 450 127 - Lactococcus lactis subsp. lactis KF147 115 239 0.00000000004 31.25 151
349 461 112 - Lactococcus lactis subsp. lactis KF147 128 245 0.0000003 27.9661 117
11 68 57 - Lactococcus lactis subsp. lactis KF147 35 92 0.000002 37.931 110
348 432 84 - MARTH_orf110 Mycoplasma arthritidis 116 200 0.000002 31.0345 106
5 122 117 - MARTH_orf119 Mycoplasma arthritidis 69 197 0.000000000007 30.2326 153
344 427 83 - MARTH_orf119 Mycoplasma arthritidis 204 286 0.00000000004 36.9048 153
11 73 62 - MARTH_orf140 Mycoplasma arthritidis 25 86 0.00000001 39.6825 124
343 453 110 - MARTH_orf140 Mycoplasma arthritidis 145 254 0.00000005 27.027 124
343 439 96 - MARTH_orf375 Mycoplasma arthritidis 194 287 0.00000000000002 41.2371 174
317 446 129 - MARTH_orf376 Mycoplasma arthritidis 105 233 4e-19 35.3846 215
21 121 100 - MARTH_orf376 Mycoplasma arthritidis 17 120 0.00000001 33.6538 215
329 449 120 - MARTH_orf399 Mycoplasma arthritidis 623 744 0.0000000000001 27.0492 168
346 440 94 - MARTH_orf400 Mycoplasma arthritidis 200 294 0.00000000000003 34.7368 174
346 439 93 - MARTH_orf539 Mycoplasma arthritidis 142 234 0.00000003 29.7872 122
340 447 107 - MARTH_orf560 Mycoplasma arthritidis 133 242 0.0000004 27.9279 112
328 432 104 - MARTH_orf575 Mycoplasma arthritidis 127 231 0.00000001 29.2453 125
21 69 48 - MARTH_orf575 Mycoplasma arthritidis 32 80 0.0000002 42.8571 125
23 121 98 - MARTH_orf625 Mycoplasma arthritidis 71 172 0.0000000001 30.7692 142
315 431 116 - MARTH_orf625 Mycoplasma arthritidis 149 267 0.000000003 28.3333 142
294 558 264 - MARTH_orf631 Mycoplasma arthritidis 181 443 <1e-50 44.5283 514
6 135 129 - MARTH_orf631 Mycoplasma arthritidis 16 141 5e-28 48.4615 514
7 103 96 - MARTH_orf684 Mycoplasma arthritidis 376 475 0.00000005 29.703 120
349 432 83 - MARTH_orf685 Mycoplasma arthritidis 491 573 0.0000000006 32.1429 137
280 446 166 - MARTH_orf821 Mycoplasma arthritidis 348 507 0.000000008 21.3873 127
289 496 207 - MARTH_orf836 Mycoplasma arthritidis 377 566 1e-32 36.8421 331
7 104 97 - MARTH_orf836 Mycoplasma arthritidis 32 128 3e-21 45.9184 331
327 449 122 - MARTH_orf864 Mycoplasma arthritidis 189 313 0.0000000000002 31.4961 167
22 106 84 - MARTH_orf864 Mycoplasma arthritidis 86 178 0.0000004 35.1064 167
337 548 211 - Caulobacter crescentus NA1000 128 326 1e-37 36.7925 380
7 113 106 - Caulobacter crescentus NA1000 3 108 1e-17 42.0561 380
343 440 97 - Caulobacter crescentus NA1000 139 238 0.000000000004 33 161
10 104 94 - Caulobacter crescentus NA1000 11 109 0.00000009 31 161
335 422 87 - Caulobacter crescentus NA1000 129 212 0.00000003 41.7582 127
23 112 89 - Caulobacter crescentus NA1000 30 131 0.000000002 32.3529 137
331 424 93 - Caulobacter crescentus NA1000 123 216 3e-17 41.4894 205
21 111 90 - Caulobacter crescentus NA1000 17 105 0.000000000000008 39.5604 205
336 427 91 - Caulobacter crescentus NA1000 133 223 0.0000000008 32.6087 141
321 428 107 - Caulobacter crescentus NA1000 127 233 0.00000000000008 38.5321 175
7 105 98 - Caulobacter crescentus NA1000 14 122 0.0000007 33.3333 175
347 409 62 - Caulobacter crescentus NA1000 159 217 0.000000004 50.7937 135
5 67 62 - Caulobacter crescentus NA1000 322 383 0.000003 31.746 135
332 430 98 - Caulobacter crescentus NA1000 140 237 0.000000000004 32.3232 161
5 79 74 - Caulobacter crescentus NA1000 20 99 0.0000002 36.25 161
349 449 100 - Caulobacter crescentus NA1000 188 286 0.000000000009 27.7228 158
349 436 87 - Caulobacter crescentus NA1000 494 578 0.0000000009 37.5 140
6 102 96 - Caulobacter crescentus NA1000 356 453 0.00000002 30.303 140
6 110 104 - Caulobacter crescentus NA1000 14 123 0.00000000001 30 157
301 432 131 - Caulobacter crescentus NA1000 105 233 0.0000000001 30.303 157
315 448 133 - Caulobacter crescentus NA1000 123 256 0.0000000000003 28.8889 171
3 104 101 - Caulobacter crescentus NA1000 17 122 0.000004 34.5794 171
323 443 120 - Caulobacter crescentus NA1000 128 240 0.00000000001 30.5785 157
348 409 61 - Caulobacter crescentus NA1000 138 195 0.0000005 41.9355 117
296 436 140 - Caulobacter crescentus NA1000 92 227 3e-23 43.2624 257
7 108 101 - Caulobacter crescentus NA1000 6 107 0.00000000003 34.2857 257
311 435 124 - Caulobacter crescentus NA1000 117 240 0.00000002 32.8125 129
22 68 46 - Caulobacter crescentus NA1000 49 95 0.0000004 42.5532 129
336 425 89 - Caulobacter crescentus NA1000 115 204 2e-16 42.2222 198
27 104 77 - Caulobacter crescentus NA1000 25 94 0.000000002 39.2405 198
304 489 185 - Caulobacter crescentus NA1000 96 292 2e-16 27.1357 198
6 105 99 - Caulobacter crescentus NA1000 1 106 0.000000000001 33.0189 198
23 68 45 - Caulobacter crescentus NA1000 515 560 0.000001 43.4783 114
332 432 100 - Caulobacter crescentus NA1000 122 221 0.00000000003 36.6337 153
9 91 82 - Caulobacter crescentus NA1000 11 91 0.00000000004 37.3494 153
6 103 97 - Caulobacter crescentus NA1000 3 103 0.00000004 28.4314 126
348 428 80 - Caulobacter crescentus NA1000 402 481 0.00000005 30.8642 126
336 421 85 - Caulobacter crescentus NA1000 133 218 0.0000000001 36.0465 148
6 102 96 - Caulobacter crescentus NA1000 4 109 0.00000008 30.1887 148
337 446 109 - Caulobacter crescentus NA1000 430 529 0.0000005 31.5315 117
335 442 107 - Caulobacter crescentus NA1000 145 251 0.0000009 28.8288 117
348 431 83 - Caulobacter crescentus NA1000 466 547 0.000002 35.7143 111
332 436 104 - Caulobacter crescentus NA1000 135 238 0.0000000000006 35.2381 168
320 475 155 - Caulobacter crescentus NA1000 116 267 6e-38 48.0769 384
6 105 99 - Caulobacter crescentus NA1000 14 112 5e-27 52 384
332 435 103 - Caulobacter crescentus NA1000 118 220 0.000003 30.7692 110
333 436 103 - Caulobacter crescentus NA1000 136 239 0.000000002 27.8846 138
349 437 88 - Caulobacter crescentus NA1000 513 598 0.00000000001 44.4444 157
22 103 81 - Caulobacter crescentus NA1000 391 473 0.0000000001 40.4762 157
325 428 103 - Caulobacter crescentus NA1000 108 211 0.000000008 27.8846 132
7 119 112 - Caulobacter crescentus NA1000 5 117 0.00000004 29.3103 132
7 107 100 - Caulobacter crescentus NA1000 5 104 0.00000000007 33.0097 150
318 426 108 - Caulobacter crescentus NA1000 102 209 0.00000002 30.2752 150
349 430 81 - Caulobacter crescentus NA1000 141 221 0.00000000000001 46.3415 183
6 129 123 - Caulobacter crescentus NA1000 10 134 0.00000000001 30.7087 183
348 431 83 - Caulobacter crescentus NA1000 537 617 0.0000000002 39.2857 146
25 102 77 - Caulobacter crescentus NA1000 419 497 0.0000000003 40 146
27 103 76 - Caulobacter crescentus NA1000 378 455 0.000000001 39.2405 139
348 436 88 - Caulobacter crescentus NA1000 494 579 0.0000001 32.5843 139
308 456 148 - Caulobacter crescentus NA1000 98 245 0.000000000000001 28.8591 192
7 103 96 - Caulobacter crescentus NA1000 4 103 0.0000000002 35.2381 192
7 105 98 - Caulobacter crescentus NA1000 7 105 0.0000000001 36 148
349 436 87 - Caulobacter crescentus NA1000 134 219 0.000000002 32.9545 137
6 97 91 - Caulobacter crescentus NA1000 1 92 0.0000001 26.8817 137
286 462 176 - Caulobacter crescentus NA1000 55 252 0.00000000003 26.1084 153
9 100 91 - Caulobacter crescentus NA1000 13 106 0.000000001 32.6316 153
294 560 266 - MCJ_000160 Mycoplasma conjunctivae 324 597 7e-39 34.2857 386
7 104 97 - MCJ_000160 Mycoplasma conjunctivae 34 130 2e-19 46.9388 386
346 448 102 - MCJ_000370 Mycoplasma conjunctivae 134 235 0.00000006 28.1553 119
320 410 90 - MCJ_000450 Mycoplasma conjunctivae 120 210 0.00000003 30.7692 122
6 100 94 - MCJ_000740 Mycoplasma conjunctivae 1 96 0.0000000001 37.7551 143
349 427 78 - MCJ_000740 Mycoplasma conjunctivae 133 210 0.0000001 38.75 143
349 420 71 - MCJ_000760 Mycoplasma conjunctivae 84 153 0.00000002 38.8889 124
322 444 122 - MCJ_002400 Mycoplasma conjunctivae 128 253 0.0000000000001 28.5714 168
329 450 121 - MCJ_002410 Mycoplasma conjunctivae 596 718 2e-18 29.2683 210
299 450 151 - MCJ_003270 Mycoplasma conjunctivae 149 294 7e-26 37.5 274
1 100 99 - MCJ_003270 Mycoplasma conjunctivae 1 91 0.000000002 36 274
321 532 211 - MCJ_004400 Mycoplasma conjunctivae 242 449 0.000000000000009 25.1142 178
294 449 155 - MCJ_004410 Mycoplasma conjunctivae 215 371 6e-19 30.303 214
6 121 115 - MCJ_004660 Mycoplasma conjunctivae 65 191 0.00000000005 29.9213 146
344 408 64 - MCJ_004660 Mycoplasma conjunctivae 199 263 0.000000004 38.4615 146
327 446 119 - MCJ_004670 Mycoplasma conjunctivae 112 234 0.00000000000002 36.2903 176
21 113 92 - MCJ_004670 Mycoplasma conjunctivae 18 111 0.000000001 33.3333 176
316 441 125 - MCJ_004680 Mycoplasma conjunctivae 125 250 7e-16 38.5827 188
280 558 278 - MCJ_005870 Mycoplasma conjunctivae 164 438 <1e-50 45.3571 564
26 128 102 - MCJ_005870 Mycoplasma conjunctivae 30 127 2e-28 59.2233 564
349 427 78 - MCJ_007040 Mycoplasma conjunctivae 408 485 0.000008 32.9114 101
348 427 79 - MCJ_007200 Mycoplasma conjunctivae 132 209 0.000002 33.75 107
329 496 167 - MHO_0740 Mycoplasma hominis 409 560 5e-31 38.6905 317
7 104 97 - MHO_0740 Mycoplasma hominis 31 127 1e-20 45.9184 317
288 440 152 - MHO_1540 Mycoplasma hominis 133 290 0.000000000000006 27.2152 179
329 449 120 - MHO_1550 Mycoplasma hominis 655 776 0.00000000000008 27.8689 169
316 474 158 - MHO_1970 Mycoplasma hominis 103 261 4e-18 33.5404 206
21 131 110 - MHO_1970 Mycoplasma hominis 17 132 0.00000000002 35.8974 206
316 436 120 - MHO_1980 Mycoplasma hominis 167 287 0.000000000000003 37.9032 182
12 80 68 - MHO_1980 Mycoplasma hominis 8 81 0.0000001 37.8378 182
25 103 78 - MHO_2310 Mycoplasma hominis 386 465 0.000003 33.3333 104
346 439 93 - MHO_2320 Mycoplasma hominis 491 580 0.00000006 33.6842 118
6 103 97 - MHO_3520 Mycoplasma hominis 89 195 0.000000000001 30.8411 159
344 430 86 - MHO_3520 Mycoplasma hominis 223 308 0.00000000004 36.7816 159
347 436 89 - MHO_3570 Mycoplasma hominis 147 236 0.0000003 28.8889 113
7 103 96 - MHO_3820 Mycoplasma hominis 382 481 0.00000001 33.0097 125
347 432 85 - MHO_3820 Mycoplasma hominis 519 601 0.000003 27.907 125
349 432 83 - MHO_3830 Mycoplasma hominis 501 583 0.000000005 36.3636 127
346 448 102 - MHO_4360 Mycoplasma hominis 140 234 0.00000000009 32.0388 143
23 131 108 - MHO_4360 Mycoplasma hominis 29 149 0.000008 28.8 143
294 559 265 - MHO_4450 Mycoplasma hominis 180 443 <1e-50 45.3184 566
3 144 141 - MHO_4450 Mycoplasma hominis 12 153 3e-27 45.2055 566
305 435 130 - MHO_4960 Mycoplasma hominis 92 221 0.000000006 27.4809 127
21 105 84 - Lactococcus lactis subsp. lactis KF147 42 132 0.00000000000006 39.5604 265
287 449 162 - Lactococcus lactis subsp. lactis KF147 92 265 2e-24 33.908 265
345 409 64 - Lactococcus lactis subsp. lactis KF147 150 210 0.00000008 47.6923 121
311 473 162 - Lactococcus lactis subsp. lactis KF147 95 279 0.000001 23.6559 144
341 430 89 - Lactococcus lactis subsp. lactis KF147 385 473 0.0000000002 32.2222 144
6 121 115 - Lactococcus lactis subsp. lactis KF147 4 122 0.000006 28.0992 148
298 431 133 - Lactococcus lactis subsp. lactis KF147 89 217 0.00000000007 31.3433 148
22 105 83 - Lactococcus lactis subsp. lactis KF147 21 112 0.000002 32.2581 164
349 450 101 - Lactococcus lactis subsp. lactis KF147 150 249 0.0000000000009 32.3529 164
338 449 111 - Lactococcus lactis subsp. lactis KF147 155 264 0.00000000007 26.7857 148
5 100 95 - Lactococcus lactis subsp. lactis KF147 1 107 0.00000000001 36.4486 158
343 425 82 - Lactococcus lactis subsp. lactis KF147 139 219 0.000000000005 44.5783 158
7 141 134 - Lactococcus lactis subsp. lactis KF147 7 147 0.00000000000006 35.4167 276
318 451 133 - Lactococcus lactis subsp. lactis KF147 111 243 1e-25 38.806 276
285 439 154 - Lactococcus lactis subsp. lactis KF147 46 220 0.000003 22.905 110
7 102 95 - Lactococcus lactis subsp. lactis KF147 3 95 0.000002 30.303 110
1 101 100 - Lactococcus lactis subsp. lactis KF147 1 103 0.000000000000003 39.0476 258
317 451 134 - Lactococcus lactis subsp. lactis KF147 109 242 1e-23 35.5556 258
319 441 122 - Lactococcus lactis subsp. lactis KF147 124 247 2e-17 31.4516 204
328 449 121 - Lactococcus lactis subsp. lactis KF147 133 257 0.0000000000007 26.4 165
6 112 106 - Lactococcus lactis subsp. lactis KF147 1 110 0.0000001 30.9735 120
349 409 60 - Lactococcus lactis subsp. lactis KF147 138 197 0.0000001 44.6154 120
336 408 72 - Lactococcus lactis subsp. lactis KF147 149 217 0.000009 39.726 104
298 442 144 - Lactococcus lactis subsp. lactis KF147 84 228 0.00000007 24.3243 131
19 124 105 - Lactococcus lactis subsp. lactis KF147 13 123 0.000000006 29.4643 131
316 408 92 - Lactococcus lactis subsp. lactis KF147 105 193 0.0000002 36.5591 119
325 447 122 - Lactococcus lactis subsp. lactis KF147 123 253 0.000001 28.7879 112
350 436 86 - Lactococcus lactis subsp. lactis KF147 135 219 0.00000003 35.6322 126
337 432 95 - Lactococcus lactis subsp. lactis KF147 475 569 0.00001 31.9588 119
22 103 81 - Lactococcus lactis subsp. lactis KF147 366 448 0.0000002 31.7647 119
343 432 89 - Lactococcus lactis subsp. lactis KF147 518 604 0.0000001 28.8889 145
25 103 78 - Lactococcus lactis subsp. lactis KF147 405 484 0.0000000001 40.7407 145
318 418 100 - Lactococcus lactis subsp. lactis KF147 108 207 0.000000000007 32.6733 157
26 126 100 - Lactococcus lactis subsp. lactis KF147 26 126 0.00000002 30.7692 178
317 437 120 - Lactococcus lactis subsp. lactis KF147 109 228 0.00000000000002 32.2314 178
6 103 97 - Lactococcus lactis subsp. lactis KF147 1 109 0.0000002 32.4324 212
320 437 117 - Lactococcus lactis subsp. lactis KF147 115 232 3e-18 37.8151 212
347 443 96 - Lactococcus lactis subsp. lactis KF147 144 232 0.0000000000005 39.1753 182
6 118 112 - Lactococcus lactis subsp. lactis KF147 1 125 0.000000000000008 32.8 182
349 443 94 - Lactococcus lactis subsp. lactis KF147 476 577 0.0000001 30.4762 122
22 103 81 - Lactococcus lactis subsp. lactis KF147 354 436 0.00000007 33.3333 122
7 103 96 - Lactococcus lactis subsp. lactis KF147 425 522 0.00000000005 35.3535 150
23 91 68 - Lactococcus lactis subsp. lactis KF147 357 427 0.000000004 43.0556 133
22 105 83 - Lactococcus lactis subsp. lactis KF147 23 117 0.000000001 32.6316 268
302 449 147 - Lactococcus lactis subsp. lactis KF147 113 260 8e-25 38.5135 268
328 439 111 - Lactococcus lactis subsp. lactis KF147 410 521 0.00000000006 33.0357 188
346 436 90 - Lactococcus lactis subsp. lactis KF147 141 232 0.000000000000002 44.5652 188
348 437 89 - Lactococcus lactis subsp. lactis KF147 138 227 0.0000002 30 118
293 441 148 - Lactococcus lactis subsp. lactis KF147 99 250 0.00000000000006 25 175
321 440 119 - Lactococcus lactis subsp. lactis KF147 127 247 4e-20 37.3984 228
22 120 98 - Lactococcus lactis subsp. lactis KF147 20 118 1e-23 49.4949 310
318 495 177 - Lactococcus lactis subsp. lactis KF147 105 299 1e-29 36.8159 310
349 428 79 - Lactococcus lactis subsp. lactis KF147 121 200 0.000000005 38.75 132
7 125 118 - Lactococcus lactis subsp. lactis KF147 4 141 0.00000000006 29.2857 151
319 408 89 - Lactococcus lactis subsp. lactis KF147 111 200 0.00000000003 38.8889 151
342 409 67 - Lactococcus lactis subsp. lactis KF147 136 203 0.000000002 46.3768 166
4 96 92 - Lactococcus lactis subsp. lactis KF147 2 103 0.0000000000005 33.3333 166
7 67 60 - Lactococcus lactis subsp. lactis KF147 333 392 0.0000002 40.9836 119
331 433 102 - Lactococcus lactis subsp. lactis KF147 449 549 0.0000002 32.6923 119
328 442 114 - Lactococcus lactis subsp. lactis KF147 439 561 0.000001 28.5714 111
348 431 83 - Lactococcus lactis subsp. lactis KF147 486 566 0.000001 32.1429 139
15 112 97 - Lactococcus lactis subsp. lactis KF147 357 455 0.0000000007 34 139
6 105 99 - Lactococcus lactis subsp. lactis KF147 3 111 0.000000001 31.1927 202
319 427 108 - Lactococcus lactis subsp. lactis KF147 114 220 4e-17 43.1193 202
6 101 95 - Lactococcus lactis subsp. lactis KF147 1 97 0.0000000002 36.7347 265
303 448 145 - Lactococcus lactis subsp. lactis KF147 79 235 2e-24 37.5796 265
290 412 122 - Lactococcus lactis subsp. lactis KF147 76 202 0.00000003 30.7087 144
24 120 96 - Lactococcus lactis subsp. lactis KF147 21 120 0.0000000002 33 144
347 420 73 - Lactococcus lactis subsp. lactis KF147 439 508 0.000004 39.1892 107
6 104 98 - Lactococcus lactis subsp. lactis KF147 1 105 0.00000000002 35.8491 215
318 451 133 - Lactococcus lactis subsp. lactis KF147 109 241 1e-18 33.5821 215
350 436 86 - Lactococcus lactis subsp. lactis KF147 132 217 0.0000002 31.0345 149
6 105 99 - Lactococcus lactis subsp. lactis KF147 4 103 0.00000000006 35.2941 149
6 120 114 - Lactococcus lactis subsp. lactis KF147 3 122 0.00000000000001 32.5 180
321 429 108 - Lactococcus lactis subsp. lactis KF147 112 219 0.00000000000001 36.6972 180
26 133 107 - Lactococcus lactis subsp. lactis KF147 26 133 0.000000002 31.5789 200
332 444 112 - Lactococcus lactis subsp. lactis KF147 122 233 7e-17 39.823 200
6 105 99 - Lactococcus lactis subsp. lactis KF147 5 105 5e-19 41.5842 451
288 558 270 - Lactococcus lactis subsp. lactis KF147 74 345 <1e-50 37.2263 451
321 437 116 - Lactococcus lactis subsp. lactis KF147 89 205 0.0000001 24.7863 120
349 438 89 - Lactococcus lactis subsp. lactis KF147 142 232 0.0000000004 32.967 141
20 67 47 - Lactococcus lactis subsp. lactis KF147 35 82 0.000002 37.5 151
349 432 83 - Lactococcus lactis subsp. lactis KF147 155 238 0.00000000004 39.2857 151
327 427 100 - Lactococcus lactis subsp. lactis KF147 102 201 0.00000001 28.7129 129
348 439 91 - Lactococcus lactis subsp. lactis KF147 474 562 0.00000000002 35.8696 154
316 457 141 - Lactococcus lactis subsp. lactis KF147 102 236 0.000000001 33.0986 138
349 433 84 - Lactococcus lactis subsp. lactis KF147 404 487 0.000008 29.4118 136
327 425 98 - Lactococcus lactis subsp. lactis KF147 121 218 0.000002 32.0755 136
1 103 102 - Lactococcus lactis subsp. lactis KF147 1 105 0.000000002 33.9623 136
6 104 98 - Bacillus subtilis subsp. subtilis 20 126 0.00000000004 31.7757 154
327 428 101 - Bacillus subtilis subsp. subtilis 138 238 0.0000000001 30.3922 154
332 451 119 - Bacillus subtilis subsp. subtilis 100 218 2e-18 35 217
30 104 74 - Bacillus subtilis subsp. subtilis 1 82 0.0000001 39.0244 217
318 495 177 - Bacillus subtilis subsp. subtilis 104 287 7e-33 42.4731 342
7 139 132 - Bacillus subtilis subsp. subtilis 4 135 9e-22 40.6015 342
337 432 95 - Bacillus subtilis subsp. subtilis 452 544 0.000001 34.375 115
320 427 107 - Bacillus subtilis subsp. subtilis 99 204 0.0000000002 33.945 149
6 68 62 - Bacillus subtilis subsp. subtilis 1 62 0.00000002 39.6825 149
16 103 87 - Bacillus subtilis subsp. subtilis 342 430 0.00000000002 41.1111 157
348 439 91 - Bacillus subtilis subsp. subtilis 469 557 0.00000002 35.8696 157
349 427 78 - Bacillus subtilis subsp. subtilis 394 471 0.00000001 34.1772 133
17 68 51 - Bacillus subtilis subsp. subtilis 33 84 0.0000009 42.3077 117
6 118 112 - Bacillus subtilis subsp. subtilis 1 118 5e-16 33.8983 197
327 429 102 - Bacillus subtilis subsp. subtilis 116 217 0.00000000000006 34.9515 197
349 439 90 - Bacillus subtilis subsp. subtilis 479 566 0.00000002 34.0659 131
23 105 82 - Bacillus subtilis subsp. subtilis 357 440 0.000001 35.2941 131
6 137 131 - Bacillus subtilis subsp. subtilis 3 145 0.0000000000002 32.8671 174
348 425 77 - Bacillus subtilis subsp. subtilis 145 221 0.0000000005 38.4615 174
347 436 89 - Bacillus subtilis subsp. subtilis 129 217 0.000000001 36.6667 141
21 66 45 - Bacillus subtilis subsp. subtilis 19 64 0.000002 43.4783 141
343 456 113 - Bacillus subtilis subsp. subtilis 133 246 7e-25 42.1053 273
6 101 95 - Bacillus subtilis subsp. subtilis 4 101 4e-16 38.7755 273
304 458 154 - Bacillus subtilis subsp. subtilis 92 245 1e-25 36.9427 280
6 101 95 - Bacillus subtilis subsp. subtilis 1 98 2e-18 41.8367 280
347 436 89 - Bacillus subtilis subsp. subtilis 138 227 0.000000006 31.1111 135
21 103 82 - Bacillus subtilis subsp. subtilis 17 101 0.00000004 33.3333 135
319 428 109 - Bacillus subtilis subsp. subtilis 112 219 0.00000000000002 39.0909 183
23 111 88 - Bacillus subtilis subsp. subtilis 21 113 0.000000007 33.6842 183
302 426 124 - Bacillus subtilis subsp. subtilis 89 216 0.0000000001 31.25 150
7 103 96 - Bacillus subtilis subsp. subtilis 26 123 0.0000001 32.3232 124
343 436 93 - Bacillus subtilis subsp. subtilis 156 249 0.0000004 30.8511 124
322 451 129 - Bacillus subtilis subsp. subtilis 121 250 1e-21 37.6923 245
22 110 88 - Bacillus subtilis subsp. subtilis 27 120 0.0000000001 36.1702 245
23 117 94 - Bacillus subtilis subsp. subtilis 21 117 0.000007 26.8041 109
318 507 189 - Bacillus subtilis subsp. subtilis 103 302 1e-33 39.5 349
21 105 84 - Bacillus subtilis subsp. subtilis 17 101 3e-21 47.0588 349
5 103 98 - Bacillus subtilis subsp. subtilis 3 103 0.00000001 34.5794 133
319 456 137 - Bacillus subtilis subsp. subtilis 111 244 0.0000009 24.6377 133
331 412 81 - Bacillus subtilis subsp. subtilis 122 202 0.0000004 34.1463 120
323 441 118 - Bacillus subtilis subsp. subtilis 109 223 7e-16 38.6555 196
21 105 84 - Bacillus subtilis subsp. subtilis 21 102 0.00000000009 36.4706 196
6 112 106 - Bacillus subtilis subsp. subtilis 1 105 0.0000003 33.6449 121
287 414 127 - Bacillus subtilis subsp. subtilis 73 211 1e-16 30.9353 202
23 100 77 - Bacillus subtilis subsp. subtilis 25 108 0.00000000008 35.7143 202
319 427 108 - Bacillus subtilis subsp. subtilis 114 221 0.00000000000002 35.7798 183
23 100 77 - Bacillus subtilis subsp. subtilis 23 106 0.00000000002 38.0952 183
344 443 99 - Bacillus subtilis subsp. subtilis 121 219 0.000002 26 114
283 449 166 - Bacillus subtilis subsp. subtilis 61 239 5e-20 31.6667 231
6 104 98 - Bacillus subtilis subsp. subtilis 1 105 0.00000000000007 42.4528 231
333 451 118 - Bacillus subtilis subsp. subtilis 121 238 5e-19 38.6555 223
6 100 94 - Bacillus subtilis subsp. subtilis 1 98 0.0000000000009 39.3939 223
349 449 100 - Bacillus subtilis subsp. subtilis 187 285 0.0000000000004 34.6535 172
348 449 101 - Bacillus subtilis subsp. subtilis 148 247 0.00000000003 30.3922 156
22 110 88 - Bacillus subtilis subsp. subtilis 20 116 0.000002 32.6733 156
318 449 131 - Bacillus subtilis subsp. subtilis 106 236 3e-21 37.1212 241
6 146 140 - Bacillus subtilis subsp. subtilis 1 134 0.00000000002 30.3448 241
304 423 119 - Bacillus subtilis subsp. subtilis 578 691 0.0000003 28.3333 121
322 431 109 - Bacillus subtilis subsp. subtilis 115 225 0.0000000002 30.6306 148
320 432 112 - Bacillus subtilis subsp. subtilis 113 223 3e-17 40.708 207
6 100 94 - Bacillus subtilis subsp. subtilis 1 104 0.0000000002 29.8077 207
7 103 96 - Bacillus subtilis subsp. subtilis 363 460 0.000000008 31.3131 134
349 432 83 - Bacillus subtilis subsp. subtilis 482 562 0.00000002 35.7143 132
319 426 107 - Bacillus subtilis subsp. subtilis 119 226 0.0000000005 29.6296 145
324 438 114 - Bacillus subtilis subsp. subtilis 399 512 0.00000003 27.8261 145
332 440 108 - Bacillus subtilis subsp. subtilis 134 243 2e-16 34.5455 199
293 451 158 - Bacillus subtilis subsp. subtilis 98 258 4e-20 29.0123 232
343 449 106 - Bacillus subtilis subsp. subtilis 139 245 0.000000000004 33.6449 163
321 440 119 - Bacillus subtilis subsp. subtilis 125 245 1e-20 38.7097 236
6 130 124 - Bacillus subtilis subsp. subtilis 8 146 0.0000008 34.5324 236
293 444 151 - Bacillus subtilis subsp. subtilis 98 251 4e-16 28.3871 198
321 440 119 - Bacillus subtilis subsp. subtilis 132 252 2e-16 30.5785 201
22 74 52 - Bacillus subtilis subsp. subtilis 35 87 0.000007 41.5094 201
318 457 139 - Bacillus subtilis subsp. subtilis 122 264 0.0000000000001 25.8741 176
315 439 124 - Bacillus subtilis subsp. subtilis 94 219 0.0000007 28.3465 118
322 432 110 - Bacillus subtilis subsp. subtilis 454 555 0.000000003 36.036 139
22 120 98 - Bacillus subtilis subsp. subtilis 353 446 0.0000001 35.6436 139
319 435 116 - Bacillus subtilis subsp. subtilis 104 220 0.00000000002 29.0598 156
19 136 117 - Bacillus subtilis subsp. subtilis 17 131 0.0000006 29.5082 156
22 143 121 - Bacillus subtilis subsp. subtilis 17 130 0.0000002 27.8689 123
327 422 95 - Bacillus subtilis subsp. subtilis 152 247 3e-22 54.1667 250
23 119 96 - Bacillus subtilis subsp. subtilis 65 159 0.0000000000005 37.7551 250
23 103 80 - Bacillus subtilis subsp. subtilis 337 418 0.000000003 37.3494 138
339 438 99 - Bacillus subtilis subsp. subtilis 445 544 0.000000005 33.0097 138
320 436 116 - Bacillus subtilis subsp. subtilis 104 219 0.0000000000002 29.9145 175
6 102 96 - Bacillus subtilis subsp. subtilis 1 97 0.00000002 31.6327 175
7 142 135 - Bacillus subtilis subsp. subtilis 366 491 0.000000000005 34.7826 162
339 432 93 - Bacillus subtilis subsp. subtilis 490 583 0.000003 29.8969 162
349 436 87 - Bacillus subtilis subsp. subtilis 468 550 0.0000003 31.8182 121
22 103 81 - Bacillus subtilis subsp. subtilis 346 428 0.000001 33.3333 121
313 440 127 - Bacillus subtilis subsp. subtilis 106 231 0.000000000003 31.25 164
18 91 73 - Bacillus subtilis subsp. subtilis 14 82 0.000006 32.4324 164
348 408 60 - Bacillus subtilis subsp. subtilis 162 218 0.000006 42.623 110
348 427 79 - Bacillus subtilis subsp. subtilis 158 233 0.0000007 40 118
327 427 100 - Bacillus subtilis subsp. subtilis 127 227 0.00000004 27.7228 129
6 120 114 - Bacillus subtilis subsp. subtilis 20 135 0.0000006 26.0504 129
342 445 103 - Bacillus subtilis subsp. subtilis 129 232 0.00000000005 34.6154 154
24 128 104 - Bacillus subtilis subsp. subtilis 22 125 0.000000002 32.4074 140
281 414 133 - Bacillus subtilis subsp. subtilis 67 205 0.0000005 24.4604 140
318 449 131 - Bacillus subtilis subsp. subtilis 110 240 1e-17 34.0909 211
6 103 97 - Bacillus subtilis subsp. subtilis 1 105 0.0000000000001 37.7358 211
322 456 134 - Bacillus subtilis subsp. subtilis 115 249 1e-33 48.1481 349
21 139 118 - Bacillus subtilis subsp. subtilis 19 126 0.0000000001 30.4 349
314 425 111 - Bacillus subtilis subsp. subtilis 100 214 0.0000000002 30.4348 149
349 457 108 - Bacillus subtilis subsp. subtilis 138 244 0.00000000001 29.3578 159
22 102 80 - Bacillus subtilis subsp. subtilis 20 102 0.0000000002 38.5542 159
332 445 113 - Bacillus subtilis subsp. subtilis 116 228 0.00000000004 32.4561 155
5 68 63 - Bacillus subtilis subsp. subtilis 3 65 0.00000004 39.0625 155
6 102 96 - Bacillus subtilis subsp. subtilis 3 97 0.0000000005 32.9897 145
304 429 125 - Bacillus subtilis subsp. subtilis 88 212 0.000002 26.9841 145
320 437 117 - Bacillus subtilis subsp. subtilis 83 199 0.0000000000001 35.5932 176
322 437 115 - Bacillus subtilis subsp. subtilis 118 234 1e-20 41.0256 236
21 103 82 - Bacillus subtilis subsp. subtilis 21 110 0.0000002 35.1648 236
318 449 131 - Bacillus subtilis subsp. subtilis 110 240 1e-17 34.0909 211
6 103 97 - Bacillus subtilis subsp. subtilis 1 105 0.00000000000004 37.7358 211
24 128 104 - Bacillus subtilis subsp. subtilis 22 125 0.000000002 32.4074 140
281 414 133 - Bacillus subtilis subsp. subtilis 67 205 0.0000003 24.4604 140
342 445 103 - Bacillus subtilis subsp. subtilis 129 232 0.00000000003 34.6154 155
349 441 92 - Bacillus subtilis subsp. subtilis 468 555 0.0000008 29.0323 117
22 103 81 - Bacillus subtilis subsp. subtilis 346 428 0.000002 33.3333 117
7 142 135 - Bacillus subtilis subsp. subtilis 366 491 0.00000000007 34.058 152
320 436 116 - Bacillus subtilis subsp. subtilis 104 219 0.0000000000003 29.9145 173
6 102 96 - Bacillus subtilis subsp. subtilis 1 97 0.00000005 30.6122 173
23 103 80 - Bacillus subtilis subsp. subtilis 358 439 0.000000003 37.3494 138
339 438 99 - Bacillus subtilis subsp. subtilis 466 565 0.000000004 33.0097 138
293 451 158 - Bacillus subtilis subsp. subtilis 98 258 2e-21 30.2469 243
332 440 108 - Bacillus subtilis subsp. subtilis 134 243 2e-16 34.5455 200
344 443 99 - Bacillus subtilis subsp. subtilis 121 219 0.000004 26 111
319 427 108 - Bacillus subtilis subsp. subtilis 114 221 0.00000000000002 35.7798 183
23 100 77 - Bacillus subtilis subsp. subtilis 23 106 0.00000000001 39.2857 183
287 414 127 - Bacillus subtilis subsp. subtilis 73 211 1e-16 30.9353 202
23 100 77 - Bacillus subtilis subsp. subtilis 25 108 0.00000000005 35.7143 202
6 112 106 - Bacillus subtilis subsp. subtilis 1 105 0.00000008 34.5794 126
5 103 98 - Bacillus subtilis subsp. subtilis 3 103 0.0000001 33.6449 125
319 456 137 - Bacillus subtilis subsp. subtilis 111 244 0.0000008 24.6377 125
349 435 86 - Bacillus subtilis subsp. subtilis 402 487 0.000004 32.1839 125
302 425 123 - Bacillus subtilis subsp. subtilis 89 215 0.0000000002 30.7087 148
6 73 67 - Bacillus subtilis subsp. subtilis 1 67 0.000001 35.2941 148
319 428 109 - Bacillus subtilis subsp. subtilis 112 219 0.00000000000002 39.0909 183
23 111 88 - Bacillus subtilis subsp. subtilis 21 113 0.000000007 33.6842 183
332 436 104 - Bacillus subtilis subsp. subtilis 123 227 0.000000004 28.5714 137
21 103 82 - Bacillus subtilis subsp. subtilis 17 101 0.00000004 33.3333 137
304 458 154 - Bacillus subtilis subsp. subtilis 92 245 1e-25 36.9427 279
6 101 95 - Bacillus subtilis subsp. subtilis 1 98 3e-18 41.8367 279
343 456 113 - Bacillus subtilis subsp. subtilis 130 243 2e-24 41.2281 270
6 101 95 - Bacillus subtilis subsp. subtilis 1 98 7e-16 37.7551 270
7 103 96 - Bacillus subtilis subsp. subtilis 305 402 0.0000000001 37.3737 150
348 439 91 - Bacillus subtilis subsp. subtilis 441 529 0.00000002 35.8696 150
332 427 95 - Bacillus subtilis subsp. subtilis 117 212 0.00000004 29.1667 129
6 120 114 - Bacillus subtilis subsp. subtilis 5 120 0.0000005 26.0504 129
327 422 95 - Bacillus subtilis subsp. subtilis 107 202 5e-22 54.1667 249
23 119 96 - Bacillus subtilis subsp. subtilis 20 114 0.0000000000003 38.7755 249
22 143 121 - Bacillus subtilis subsp. subtilis 17 130 0.0000001 27.8689 124
319 435 116 - Bacillus subtilis subsp. subtilis 103 219 0.00000000002 29.0598 156
19 136 117 - Bacillus subtilis subsp. subtilis 16 130 0.0000003 27.5 156
319 426 107 - Bacillus subtilis subsp. subtilis 119 226 0.000000002 28.7037 139
324 438 114 - Bacillus subtilis subsp. subtilis 399 512 0.00000004 26.9565 139
348 409 61 - Bacillus subtilis subsp. subtilis 103 160 0.000005 46.7742 111
322 432 110 - Bacillus subtilis subsp. subtilis 454 555 0.000000003 36.036 139
22 120 98 - Bacillus subtilis subsp. subtilis 353 446 0.0000001 35.6436 139
349 432 83 - Bacillus subtilis subsp. subtilis 567 647 0.00001 30.9524 108
315 439 124 - Bacillus subtilis subsp. subtilis 94 219 0.0000007 28.3465 118
349 432 83 - Bacillus subtilis subsp. subtilis 473 553 0.00000002 35.7143 132
7 103 96 - Bacillus subtilis subsp. subtilis 363 460 0.000000002 32.3232 139
320 432 112 - Bacillus subtilis subsp. subtilis 113 223 1e-17 41.5929 210
6 111 105 - Bacillus subtilis subsp. subtilis 1 113 0.00000000009 30.4348 210
333 451 118 - Bacillus subtilis subsp. subtilis 121 238 8e-19 38.6555 221
6 100 94 - Bacillus subtilis subsp. subtilis 1 98 0.000000000007 38.3838 221
323 441 118 - Bacillus subtilis subsp. subtilis 109 223 7e-16 38.6555 196
21 105 84 - Bacillus subtilis subsp. subtilis 21 102 0.00000000009 36.4706 196
331 412 81 - Bacillus subtilis subsp. subtilis 119 199 0.000004 32.9268 112
332 426 94 - Bacillus subtilis subsp. subtilis 117 210 0.00000004 33.6842 129
6 68 62 - Bacillus subtilis subsp. subtilis 1 62 0.0000005 34.9206 129
347 436 89 - Bacillus subtilis subsp. subtilis 128 216 0.00000001 35.5556 133
6 125 119 - Bacillus subtilis subsp. subtilis 3 133 0.0000000000002 33.5878 174
348 425 77 - Bacillus subtilis subsp. subtilis 145 221 0.0000000005 38.4615 174
349 439 90 - Bacillus subtilis subsp. subtilis 479 566 0.00000002 34.0659 130
23 105 82 - Bacillus subtilis subsp. subtilis 357 440 0.0000004 35.2941 130
6 118 112 - Bacillus subtilis subsp. subtilis 1 118 5e-16 33.8983 197
327 429 102 - Bacillus subtilis subsp. subtilis 116 217 0.00000000000006 34.9515 197
320 427 107 - Bacillus subtilis subsp. subtilis 99 204 0.00000000008 33.945 152
6 68 62 - Bacillus subtilis subsp. subtilis 1 62 0.000000006 41.2698 152
337 432 95 - Bacillus subtilis subsp. subtilis 452 544 0.000001 35.4167 117
318 495 177 - Bacillus subtilis subsp. subtilis 104 287 6e-33 42.4731 342
7 139 132 - Bacillus subtilis subsp. subtilis 4 135 9e-22 40.6015 342
320 437 117 - Bacillus subtilis subsp. subtilis 114 230 0.0000000000001 35.5932 176
322 437 115 - Bacillus subtilis subsp. subtilis 118 234 1e-20 41.0256 236
21 103 82 - Bacillus subtilis subsp. subtilis 21 110 0.0000002 35.1648 236
349 457 108 - Bacillus subtilis subsp. subtilis 138 244 0.00000000001 29.3578 160
22 102 80 - Bacillus subtilis subsp. subtilis 20 102 0.0000000001 38.5542 160
314 425 111 - Bacillus subtilis subsp. subtilis 100 214 0.0000000002 30.4348 148
318 457 139 - Bacillus subtilis subsp. subtilis 122 264 0.0000000000001 25.8741 176
321 440 119 - Bacillus subtilis subsp. subtilis 132 252 1e-16 30.5785 202
22 74 52 - Bacillus subtilis subsp. subtilis 35 87 0.000006 41.5094 202
293 444 151 - Bacillus subtilis subsp. subtilis 98 251 4e-16 28.3871 197
321 449 128 - Bacillus subtilis subsp. subtilis 122 251 1e-20 36.0902 236
1 130 129 - Bacillus subtilis subsp. subtilis 1 143 0.0000008 34.7222 236
318 449 131 - Bacillus subtilis subsp. subtilis 106 236 3e-21 37.1212 241
6 146 140 - Bacillus subtilis subsp. subtilis 1 134 0.00000000002 30.3448 241
318 507 189 - Bacillus subtilis subsp. subtilis 103 302 1e-33 39.5 349
21 105 84 - Bacillus subtilis subsp. subtilis 17 101 3e-21 47.0588 349
23 85 62 - Bacillus subtilis subsp. subtilis 21 85 0.000007 33.8462 109
322 451 129 - Bacillus subtilis subsp. subtilis 114 243 1e-21 37.6923 245
22 110 88 - Bacillus subtilis subsp. subtilis 20 113 0.0000000002 36.1702 245
7 103 96 - Bacillus subtilis subsp. subtilis 4 101 0.0000001 32.3232 124
343 436 93 - Bacillus subtilis subsp. subtilis 134 227 0.0000005 30.8511 124
17 68 51 - Bacillus subtilis subsp. subtilis 33 84 0.0000009 42.3077 117
349 427 78 - Bacillus subtilis subsp. subtilis 394 471 0.00000001 34.1772 133
332 451 119 - Bacillus subtilis subsp. subtilis 123 241 2e-18 35 217
6 104 98 - Bacillus subtilis subsp. subtilis 1 105 0.0000000001 36.7925 217
327 428 101 - Bacillus subtilis subsp. subtilis 122 222 0.00000000003 31.3725 156
6 104 98 - Bacillus subtilis subsp. subtilis 4 110 0.0000000002 30.8411 156
322 456 134 - Bacillus subtilis subsp. subtilis 143 277 1e-33 48.1481 349
21 139 118 - Bacillus subtilis subsp. subtilis 47 154 0.0000000001 30.4 349
348 427 79 - Bacillus subtilis subsp. subtilis 158 233 0.0000007 40 118
348 408 60 - Bacillus subtilis subsp. subtilis 162 218 0.000006 42.623 110
307 440 133 - Bacillus subtilis subsp. subtilis 95 231 0.000000000008 29.1971 161
18 91 73 - Bacillus subtilis subsp. subtilis 14 82 0.000006 32.4324 161
343 449 106 - Bacillus subtilis subsp. subtilis 139 245 0.000000000003 33.6449 164
322 431 109 - Bacillus subtilis subsp. subtilis 115 225 0.0000000002 30.6306 149
348 449 101 - Bacillus subtilis subsp. subtilis 138 237 0.00000000001 31.3725 160
349 449 100 - Bacillus subtilis subsp. subtilis 145 243 0.0000000000005 34.6535 171
25 132 107 - MT3186 Mycobacterium tuberculosis 21 135 2e-17 39.1304 207
329 429 100 - MT3186 Mycobacterium tuberculosis 119 218 0.000000000000002 38.6139 207
332 436 104 - Rv2688c Mycobacterium tuberculosis 130 233 0.0000000003 32.381 145
332 412 80 - MT1727 Mycobacterium tuberculosis 126 205 0.00000005 38.2716 126
319 472 153 - MT1276 Mycobacterium tuberculosis 105 259 2e-27 39.3548 294
7 104 97 - MT1276 Mycobacterium tuberculosis 4 101 8e-24 46.9388 294
349 439 90 - MT1505 Mycobacterium tuberculosis 138 227 0.0000000000007 40.6593 168
5 70 65 - MT1505 Mycobacterium tuberculosis 10 74 0.0000003 34.8485 168
6 67 61 - Rv2477c Mycobacterium tuberculosis 321 381 0.000001 30.6452 114
349 451 102 - MT3126 Mycobacterium tuberculosis 161 261 0.0000006 30.7692 116
319 498 179 - MT2098 Mycobacterium tuberculosis 106 284 2e-28 34.7826 301
26 105 79 - MT2098 Mycobacterium tuberculosis 24 103 2e-17 43.75 301
23 106 83 - Rv0073 Mycobacterium tuberculosis 23 112 0.0000000006 35.5556 142
349 438 89 - Rv0194 Mycobacterium tuberculosis 471 557 0.000000000003 35.1648 162
22 103 81 - Rv0194 Mycobacterium tuberculosis 958 1040 0.0000000004 34.5238 162
19 103 84 - Rv0194 Mycobacterium tuberculosis 342 431 0.00000003 32.967 162
349 432 83 - Rv0194 Mycobacterium tuberculosis 1080 1160 0.000003 35.7143 162
356 449 93 - Rv0820 Mycobacterium tuberculosis 156 253 0.000000008 27 133
1 100 99 - Rv0986 Mycobacterium tuberculosis 1 109 0.00000000002 34.8624 155
332 442 110 - Rv0986 Mycobacterium tuberculosis 130 239 0.000000001 30.6306 155
316 436 120 - Rv1747 Mycobacterium tuberculosis 421 540 0.0000001 28.0992 122
7 102 95 - Rv1747 Mycobacterium tuberculosis 319 415 0.0000007 28.866 122
322 449 127 - MT3764 Mycobacterium tuberculosis 404 532 0.000000000000009 28.6822 184
332 452 120 - MT3764 Mycobacterium tuberculosis 131 257 0.0000000002 32.2835 184
332 456 124 - Rv3758c Mycobacterium tuberculosis 118 244 5e-19 39.3701 221
6 101 95 - Rv3758c Mycobacterium tuberculosis 1 98 0.00000000006 33.6735 221
2 100 98 - Rv1218c Mycobacterium tuberculosis 5 103 0.0000001 37.2549 123
350 450 100 - Rv1218c Mycobacterium tuberculosis 137 236 0.000008 29.703 123
280 427 147 - b3749 Escherichia coli 335 473 0.0000000000002 33.5526 172
310 440 130 - b1709 Escherichia coli 72 224 0.0000009 29.8701 115
320 449 129 - b2306 Escherichia coli 123 252 7e-18 32.8244 211
327 445 118 - b0151 Escherichia coli 126 244 0.000000000001 36.1345 165
332 439 107 - b0765 Escherichia coli 112 219 0.000000005 36.1111 135
26 128 102 - b0765 Escherichia coli 17 124 0.000000009 34.5455 135
318 460 142 - Rv2397c Mycobacterium tuberculosis 106 248 5e-36 46.1538 367
1 105 104 - Rv2397c Mycobacterium tuberculosis 1 104 5e-19 40 367
320 432 112 - Rv1273c Mycobacterium tuberculosis 440 554 0.000005 27.1186 109
6 128 122 - b3463 Escherichia coli 1 130 0.000000000003 32.3077 162
327 427 100 - b3463 Escherichia coli 116 215 0.0000000005 31.6832 162
317 452 135 - b3455 Escherichia coli 122 255 0.00000000000008 29.4118 176
6 100 94 - b3455 Escherichia coli 5 101 0.00000000009 33.6735 176
279 408 129 - b0495 Escherichia coli 77 206 0.0000000000004 33.8462 169
6 100 94 - b0495 Escherichia coli 6 109 0.0000003 27.8846 169
320 436 116 - b0794 Escherichia coli 432 546 0.0000000000008 35.8974 167
6 106 100 - b0794 Escherichia coli 329 434 0.000000000002 34.5794 167
318 433 115 - b0794 Escherichia coli 108 221 0.00000000004 34.7458 167
1 100 99 - b0794 Escherichia coli 1 101 0.000001 33.9806 167
4 65 61 - b0820 Escherichia coli 317 377 0.0000007 40.3226 116
296 420 124 - b0820 Escherichia coli 404 506 0.000007 28.8 116
320 436 116 - b3201 Escherichia coli 109 224 0.00000000009 25.641 150
23 146 123 - b3201 Escherichia coli 19 156 0.000000004 30.4965 150
6 107 101 - b4391 Escherichia coli 323 415 0.0000002 30.7692 120
349 409 60 - b4391 Escherichia coli 163 219 0.0000007 47.541 120
347 448 101 - b1858 Escherichia coli 119 217 0.0000001 29.4118 122
6 68 62 - b1858 Escherichia coli 4 65 0.0000004 38.0952 122
7 103 96 - b1900 Escherichia coli 8 106 0.0000002 29 121
341 427 86 - b1900 Escherichia coli 392 477 0.0000004 33.3333 121
307 451 144 - b0864 Escherichia coli 100 242 9e-18 33.1034 210
7 100 93 - b0864 Escherichia coli 3 103 0.0000000001 36.2745 210
276 444 168 - b3541 Escherichia coli 76 249 0.000000000000003 28.2486 188
322 451 129 - b0652 Escherichia coli 110 238 3e-19 35.8779 222
39 100 61 - b0652 Escherichia coli 33 98 0.000005 34.8485 222
349 444 95 - b0449 Escherichia coli 477 569 0.000003 29.1667 110
7 103 96 - b0449 Escherichia coli 341 438 0.000006 27.2727 110
348 425 77 - b2149 Escherichia coli 406 482 0.0000002 32.0513 121
310 449 139 - b3725 Escherichia coli 112 252 0.000000000003 29.8611 162
7 115 108 - b3725 Escherichia coli 11 125 0.00000002 31.3559 162
278 449 171 - b1291 Escherichia coli 107 259 0.00000005 20 126
316 452 136 - b1290 Escherichia coli 117 258 0.000000000000004 29.5775 187
6 92 86 - b1290 Escherichia coli 5 87 0.000003 31.5789 187
336 427 91 - b0933 Escherichia coli 120 211 1e-19 48.913 226
1 108 107 - b0933 Escherichia coli 6 109 0.0000000005 30.5556 226
318 449 131 - b0809 Escherichia coli 106 236 6e-18 33.3333 211
6 103 97 - b0809 Escherichia coli 1 101 0.0000000000002 37.2549 211
318 504 186 - b3450 Escherichia coli 104 293 2e-29 35.9375 311
7 105 98 - b3450 Escherichia coli 4 102 4e-19 39.3939 311
320 475 155 - b2677 Escherichia coli 136 291 3e-27 36.5385 292
21 105 84 - b2677 Escherichia coli 42 132 0.00000000000002 37.3626 292
348 436 88 - b4287 Escherichia coli 138 225 0.00000002 34.8315 129
328 517 189 - b2422 Escherichia coli 116 303 6e-34 39.3782 349
7 113 106 - b2422 Escherichia coli 3 108 5e-21 44.8598 349
324 433 109 - b4106 Escherichia coli 128 237 0.0000000000007 32.7273 167
6 103 97 - b4106 Escherichia coli 4 110 0.00000002 30.5556 167
343 440 97 - b4097 Escherichia coli 140 237 0.00000000000002 36.7347 181
346 409 63 - b4096 Escherichia coli 147 209 0.000005 39.0625 109
22 103 81 - b3454 Escherichia coli 20 104 0.00000002 35.2941 129
349 428 79 - b3454 Escherichia coli 138 216 0.0000005 32.5 129
322 439 117 - b0588 Escherichia coli 117 234 0.00000000003 29.661 154
348 436 88 - b0886 Escherichia coli 474 559 0.0000003 33.7079 119
322 449 127 - b0199 Escherichia coli 114 241 4e-19 35.1562 222
6 120 114 - b0199 Escherichia coli 1 123 0.0000000008 28.4553 222
349 405 56 - b0760 Escherichia coli 136 191 0.0000002 43.8596 121
319 517 198 - b0855 Escherichia coli 120 327 5e-35 39.6226 359
6 105 99 - b0855 Escherichia coli 19 117 2e-26 52 359
27 104 77 - b0066 Escherichia coli 19 96 3e-18 47.4359 215
325 427 102 - b0066 Escherichia coli 106 208 8e-17 43.6893 215
7 103 96 - b4087 Escherichia coli 6 104 0.000000009 31.3725 132
334 430 96 - b4087 Escherichia coli 394 490 0.0000004 27.551 132
288 438 150 - b4087 Escherichia coli 67 234 0.0000004 23.6686 132
328 454 126 - b2129 Escherichia coli 113 240 4e-25 39.0625 273
6 101 95 - b2129 Escherichia coli 1 97 0.0000000002 33.6735 273
313 441 128 - b3479 Escherichia coli 102 233 0.000000000007 31.0606 159
320 429 109 - b3480 Escherichia coli 122 232 0.00000000000003 37.8378 180
6 87 81 - b3480 Escherichia coli 3 97 0.00000001 33.6842 180
320 450 130 - b2180 Escherichia coli 396 527 9e-19 29.5455 219
293 444 151 - b2180 Escherichia coli 99 252 0.0000000000002 25.1613 219
336 407 71 - b2201 Escherichia coli 116 186 0.000002 37.5 112
7 94 87 - b2211 Escherichia coli 323 412 0.00000002 34.4444 130
338 443 105 - b0127 Escherichia coli 126 230 0.00000000002 34.9057 156
7 88 81 - b0127 Escherichia coli 5 87 0.00000000007 34.9398 156
320 459 139 - b0262 Escherichia coli 108 247 1e-33 42.1429 347
1 107 106 - b0262 Escherichia coli 1 106 2e-23 43.9252 347
312 444 132 - b3540 Escherichia coli 124 257 6e-19 30.597 220
349 427 78 - b3567 Escherichia coli 406 483 0.0000000002 39.2405 147
5 103 98 - b3567 Escherichia coli 3 105 0.0000001 29.8077 147
320 438 118 - b3486 Escherichia coli 379 496 0.00000000003 31.0924 153
288 432 144 - b3486 Escherichia coli 89 231 0.00000000004 28.7671 153
2 100 98 - b3486 Escherichia coli 272 370 0.0000000006 33.6634 153
322 449 127 - b1917 Escherichia coli 118 244 5e-17 32.0312 204
7 103 96 - b1917 Escherichia coli 4 109 0.00000000007 38.3178 204
349 437 88 - b0949 Escherichia coli 157 241 0.000002 33.7079 112
318 451 133 - b3271 Escherichia coli 117 249 2e-20 35.8209 233
6 100 94 - b3271 Escherichia coli 12 109 0.0000000000001 37.3737 233
341 392 51 - MG014 Mycoplasma genitalium 506 561 0.0000000003 50 138
22 103 81 - MG015 Mycoplasma genitalium 367 449 0.000000005 35.7143 127
1 560 559 - MG042 Mycoplasma genitalium 1 559 <1e-50 70 2026
6 119 113 - MG065 Mycoplasma genitalium 232 356 0.0000000000003 33.6 163
329 427 98 - MG065 Mycoplasma genitalium 351 448 0.000000000003 35.3535 163
279 440 161 - MG079 Mycoplasma genitalium 125 300 0.00000000000002 25 174
1 78 77 - MG079 Mycoplasma genitalium 16 99 0.000006 30.9524 174
313 440 127 - MG080 Mycoplasma genitalium 648 776 6e-19 33.3333 213
3 120 117 - MG119 Mycoplasma genitalium 2 123 0.00000002 31.4516 123
326 439 113 - MG179 Mycoplasma genitalium 115 230 2e-17 37.2881 200
23 105 82 - MG179 Mycoplasma genitalium 24 109 0.00000004 31.3953 200
321 437 116 - MG180 Mycoplasma genitalium 132 248 6e-16 33.8983 187
344 560 216 - MG187 Mycoplasma genitalium 363 577 5e-27 32.287 282
2 104 102 - MG187 Mycoplasma genitalium 3 104 6e-22 40.7767 282
305 422 117 - MG290 Mycoplasma genitalium 112 220 0.0000000008 28.8136 134
344 448 104 - MG303 Mycoplasma genitalium 209 309 0.0000000004 31.4286 137
332 438 106 - MG304 Mycoplasma genitalium 99 204 0.000000003 32.7103 129
338 453 115 - MG410 Mycoplasma genitalium 216 329 0.000000000000002 28.4483 183
1 120 119 - MG410 Mycoplasma genitalium 77 205 0.000000003 30.303 183
274 429 155 - MG467 Mycoplasma genitalium 148 303 0.000000000000002 31.2102 183
23 101 78 - MG467 Mycoplasma genitalium 105 189 0.000000004 35.2941 183
22 110 88 - b0914 Escherichia coli 358 447 0.00000002 36.2637 129
349 438 89 - b0914 Escherichia coli 481 567 0.00000009 34.4444 129
298 408 110 - Rv0655 Mycobacterium tuberculosis 114 223 0.00000000000004 37.8378 178
7 105 98 - Rv0655 Mycobacterium tuberculosis 28 130 0.000000000001 38.4615 178
25 105 80 - b3195 Escherichia coli 26 111 0.00000000003 37.931 153
326 440 114 - b3195 Escherichia coli 122 236 0.00000000004 33.913 153
16 139 123 - Rv1348 Mycobacterium tuberculosis 619 732 0.000000008 31.4961 133
7 100 93 - Rv1349 Mycobacterium tuberculosis 332 427 0.0000000003 35.0515 145
322 450 128 - Rv1281c Mycobacterium tuberculosis 472 601 4e-22 35.3846 247
293 451 158 - Rv1281c Mycobacterium tuberculosis 96 257 0.00000000000004 24.6914 247
7 128 121 - Rv1272c Mycobacterium tuberculosis 397 514 0.0000000002 31.4516 147
322 408 86 - Rv2326c Mycobacterium tuberculosis 579 666 0.0000003 36.3636 119
16 106 90 - Rv2564 Mycobacterium tuberculosis 13 112 0.0000000001 36 149
346 471 125 - Rv2564 Mycobacterium tuberculosis 141 254 0.000001 29.1339 149
326 450 124 - b4035 Escherichia coli 111 235 1e-28 46.4 303
7 125 118 - b4035 Escherichia coli 4 121 4e-21 39.4958 303
274 532 258 - b1126 Escherichia coli 71 339 2e-37 35.1648 379
6 109 103 - b1126 Escherichia coli 17 119 1e-24 48.0769 379
320 450 130 - MT2898 Mycobacterium tuberculosis 107 237 1e-24 36.6412 268
22 105 83 - MT2898 Mycobacterium tuberculosis 20 103 2e-19 45.2381 268
321 432 111 - MT3890 Mycobacterium tuberculosis 130 240 0.000002 30.0885 112
22 119 97 - MT3890 Mycobacterium tuberculosis 52 146 0.000004 30.3922 112
320 444 124 - b0829 Escherichia coli 434 559 0.00000000000001 28.5714 183
343 457 114 - b0829 Escherichia coli 163 280 0.00000000000008 28.8136 183
6 128 122 - b0879 Escherichia coli 4 131 0.0000000003 30.303 145
324 429 105 - b0879 Escherichia coli 117 223 0.000000002 33.945 145
324 427 103 - b1117 Escherichia coli 121 223 0.00000000001 36.5385 157
4 104 100 - b1117 Escherichia coli 3 112 0.00000001 27.2727 157
293 440 147 - b1246 Escherichia coli 111 260 0.0000000000002 26.4901 173
25 106 81 - b1756 Escherichia coli 19 103 0.000000001 32.9412 140
316 411 95 - b1756 Escherichia coli 101 196 0.000000001 35.4167 140
349 427 78 - b1513 Escherichia coli 404 481 0.00000001 32.9114 131
18 104 86 - b1513 Escherichia coli 22 111 0.000002 27.7778 131
349 432 83 - b0448 Escherichia coli 473 553 0.0000000008 39.2857 141
343 449 106 - b1484 Escherichia coli 151 257 0.0000000000002 30.8411 172
23 113 90 - b0490 Escherichia coli 23 114 0.0000000007 34.4086 142
348 411 63 - b0490 Escherichia coli 137 200 0.00000002 42.1875 142
318 559 241 - b4524 Escherichia coli 104 352 1e-30 32.1569 322
7 125 118 - b4524 Escherichia coli 4 122 1e-23 42.0168 322
13 103 90 - b2547 Escherichia coli 17 112 0.0000001 31.9588 123
312 440 128 - b1483 Escherichia coli 105 234 5e-17 31.5385 204
314 506 192 - b1247 Escherichia coli 129 322 2e-19 28.3505 224
316 457 141 - b1441 Escherichia coli 102 243 1e-35 48.5915 364
5 104 99 - b1441 Escherichia coli 3 101 3e-21 45 364
343 470 127 - Rv1859 Mycobacterium tuberculosis 133 259 9e-24 38.2812 261
25 103 78 - Rv1859 Mycobacterium tuberculosis 16 100 0.00000000007 34.1176 261
346 449 103 - Rv0933 Mycobacterium tuberculosis 161 262 0.00000000000003 34.6154 179
2 100 98 - Rv2936 Mycobacterium tuberculosis 3 103 0.000000003 29.703 137
320 418 98 - Rv2936 Mycobacterium tuberculosis 112 209 0.0000005 30.303 137
346 428 82 - MCAP_0826 Mycoplasma capricolum subsp. capricolum 149 231 0.000000000002 37.3494 158
6 118 112 - MCAP_0826 Mycoplasma capricolum subsp. capricolum 1 121 0.000002 26.6129 158
320 431 111 - MCAP_0797 Mycoplasma capricolum subsp. capricolum 106 217 0.000000002 26.7857 133
6 72 66 - MCAP_0797 Mycoplasma capricolum subsp. capricolum 4 70 0.00000007 35.8209 133
347 428 81 - MCAP_0730 Mycoplasma capricolum subsp. capricolum 148 228 0.000002 32.9268 107
336 438 102 - MCAP_0668 Mycoplasma capricolum subsp. capricolum 262 363 0.00000000000001 34.9515 178
7 113 106 - MCAP_0668 Mycoplasma capricolum subsp. capricolum 140 248 0.00000005 33.3333 178
322 439 117 - MCAP_0667 Mycoplasma capricolum subsp. capricolum 123 241 3e-17 35.5372 200
347 460 113 - MCAP_0655 Mycoplasma capricolum subsp. capricolum 130 241 0.000000009 28.9474 127
6 63 57 - MCAP_0655 Mycoplasma capricolum subsp. capricolum 5 61 0.00000002 43.1034 127
343 502 159 - MCAP_0587 Mycoplasma capricolum subsp. capricolum 145 298 0.000000001 28.0488 134
349 440 91 - MCAP_0538 Mycoplasma capricolum subsp. capricolum 518 607 0.000000007 34.7826 128
349 394 45 - MCAP_0537 Mycoplasma capricolum subsp. capricolum 514 559 0.0000005 47.8261 111
349 450 101 - MCAP_0483 Mycoplasma capricolum subsp. capricolum 166 265 0.00000000004 32.3529 147
7 120 113 - MCAP_0483 Mycoplasma capricolum subsp. capricolum 21 144 0.000000009 34.4 147
347 454 107 - MCAP_0454 Mycoplasma capricolum subsp. capricolum 208 315 1e-22 42.5926 247
1 105 104 - MCAP_0454 Mycoplasma capricolum subsp. capricolum 4 104 0.000000007 37.2727 247
318 558 240 - MCAP_0202 Mycoplasma capricolum subsp. capricolum 105 345 <1e-50 43.2099 495
3 118 115 - MCAP_0202 Mycoplasma capricolum subsp. capricolum 2 116 2e-25 44.8276 495
344 551 207 - MCAP_0189 Mycoplasma capricolum subsp. capricolum 130 347 3e-29 35.5856 304
7 105 98 - MCAP_0189 Mycoplasma capricolum subsp. capricolum 3 102 5e-20 42 304
329 440 111 - MCAP_0164 Mycoplasma capricolum subsp. capricolum 433 545 4e-18 33.6283 208
319 441 122 - MCAP_0163 Mycoplasma capricolum subsp. capricolum 342 467 9e-16 30.1587 187
293 463 170 - MCAP_0120 Mycoplasma capricolum subsp. capricolum 202 373 2e-17 27.2727 201
2 66 64 - MCAP_0120 Mycoplasma capricolum subsp. capricolum 7 74 0.000001 32.3529 201
321 449 128 - MCAP_0119 Mycoplasma capricolum subsp. capricolum 191 322 0.0000000000001 29.5455 168
5 111 106 - MCAP_0037 Mycoplasma capricolum subsp. capricolum 9 119 0.00000000001 36.036 152
341 428 87 - MCAP_0037 Mycoplasma capricolum subsp. capricolum 407 493 0.00000002 30.6818 152
310 444 134 - MCAP_0021 Mycoplasma capricolum subsp. capricolum 211 344 0.000000000000002 32.3741 184
4 103 99 - MCAP_0021 Mycoplasma capricolum subsp. capricolum 110 218 0.0000000002 31.1927 184
336 425 89 - b0366 Escherichia coli 116 205 1e-17 45.5556 208
22 125 103 - b0366 Escherichia coli 16 113 0.0000000000002 40.566 208
316 433 117 - MS53_0660 Mycoplasma synoviae 132 249 5e-16 40.4959 188
317 446 129 - MS53_0659 Mycoplasma synoviae 106 234 8e-17 33.0769 195
22 139 117 - MS53_0659 Mycoplasma synoviae 19 138 0.0000002 27.2727 195
349 436 87 - MS53_0657 Mycoplasma synoviae 141 227 0.000000000002 42.0455 157
2 100 98 - MS53_0657 Mycoplasma synoviae 3 101 0.00000002 32 157
342 441 99 - MS53_0612 Mycoplasma synoviae 281 375 0.000000000004 36 155
6 127 121 - MS53_0612 Mycoplasma synoviae 149 279 0.00000002 35.8209 155
23 103 80 - MS53_0514 Mycoplasma synoviae 426 507 0.00000001 27.7108 125
314 444 130 - MS53_0513 Mycoplasma synoviae 443 587 0.00000002 29.5302 123
22 105 83 - MS53_0513 Mycoplasma synoviae 363 447 0.0000001 32.5581 123
294 558 264 - MS53_0508 Mycoplasma synoviae 179 446 <1e-50 46.6418 609
6 145 139 - MS53_0508 Mycoplasma synoviae 14 156 2e-30 47.2222 609
348 441 93 - MS53_0507 Mycoplasma synoviae 494 583 0.00000005 32.9787 119
303 555 252 - MS53_0383 Mycoplasma synoviae 157 381 9e-23 28.4585 247
27 100 73 - MS53_0383 Mycoplasma synoviae 28 95 0.000002 33.7838 247
304 450 146 - MS53_0346 Mycoplasma synoviae 120 263 0.000000000004 26 155
329 489 160 - MS53_0345 Mycoplasma synoviae 612 783 0.000000000000003 27.5862 182
322 496 174 - MS53_0330 Mycoplasma synoviae 438 612 1e-28 37.5691 297
7 105 98 - MS53_0330 Mycoplasma synoviae 45 142 1e-22 48.4848 297
346 444 98 - MS53_0187 Mycoplasma synoviae 237 335 0.00000000000008 32.3232 170
290 440 150 - MS53_0186 Mycoplasma synoviae 208 371 2e-16 26.8293 193
6 88 82 - MS53_0186 Mycoplasma synoviae 35 120 0.000002 32.5581 193
1 68 67 - MS53_0137 Mycoplasma synoviae 1 67 0.00000001 38.2353 125
320 431 111 - MS53_0130 Mycoplasma synoviae 105 215 0.00000008 25.8929 118
322 459 137 - MS53_0102 Mycoplasma synoviae 271 410 2e-31 43.5714 321
9 111 102 - MS53_0102 Mycoplasma synoviae 45 147 3e-25 48.5437 321
324 428 104 - MS53_0086 Mycoplasma synoviae 130 234 0.00000005 27.619 120
6 108 102 - MS53_0080 Mycoplasma synoviae 1 93 0.000002 27.1845 106
347 412 65 - MS53_0041 Mycoplasma synoviae 2 65 0.00000002 39.3939 123
349 429 80 - MS53_0034 Mycoplasma synoviae 137 217 0.0000000006 37.037 136
342 423 81 - MHP7448_0624 Mycoplasma hyopneumoniae 7448 438 519 0.0000004 40 113
1 103 102 - MHP7448_0605 Mycoplasma hyopneumoniae 7448 2 106 0.000002 31.1321 106
294 560 266 - MHP7448_0542 Mycoplasma hyopneumoniae 7448 177 439 <1e-50 45.5882 599
6 146 140 - MHP7448_0542 Mycoplasma hyopneumoniae 7448 10 159 3e-29 48.3444 599
347 427 80 - MHP7448_0514 Mycoplasma hyopneumoniae 7448 410 489 0.000000001 37.037 133
333 425 92 - MHP7448_0514 Mycoplasma hyopneumoniae 7448 129 220 0.000003 32.2581 133
317 444 127 - MHP7448_0502 Mycoplasma hyopneumoniae 7448 127 257 0.0000000000001 28.2443 169
338 450 112 - MHP7448_0501 Mycoplasma hyopneumoniae 7448 606 718 3e-17 28.3186 199
346 435 89 - MHP7448_0469 Mycoplasma hyopneumoniae 7448 133 221 0.000000003 31.1111 131
25 122 97 - MHP7448_0452 Mycoplasma hyopneumoniae 7448 82 187 0.000000007 29.2453 127
344 408 64 - MHP7448_0452 Mycoplasma hyopneumoniae 7448 194 258 0.00000003 33.8462 127
347 410 63 - MHP7448_0383 Mycoplasma hyopneumoniae 7448 127 188 0.000002 40 106
315 490 175 - MHP7448_0379 Mycoplasma hyopneumoniae 7448 84 244 2e-23 32.3864 252
315 479 164 - MHP7448_0369 Mycoplasma hyopneumoniae 7448 473 640 2e-33 42.8571 339
7 104 97 - MHP7448_0369 Mycoplasma hyopneumoniae 7448 39 135 1e-19 47.9592 339
323 425 102 - MHP7448_0361 Mycoplasma hyopneumoniae 7448 128 230 0.00000004 28.1553 121
6 112 106 - MHP7448_0340 Mycoplasma hyopneumoniae 7448 1 103 0.000000002 35.1852 133
347 430 83 - MHP7448_0340 Mycoplasma hyopneumoniae 7448 126 207 0.000000003 35.7143 133
6 113 107 - MHP7448_0315 Mycoplasma hyopneumoniae 7448 1 105 0.000000005 34.8214 129
316 427 111 - MHP7448_0315 Mycoplasma hyopneumoniae 7448 99 205 0.0000001 34.5133 129
320 420 100 - MHP7448_0314 Mycoplasma hyopneumoniae 7448 99 198 0.0000001 32.3529 116
6 100 94 - MHP7448_0314 Mycoplasma hyopneumoniae 7448 1 92 0.0000003 33.6842 116
6 100 94 - MHP7448_0306 Mycoplasma hyopneumoniae 7448 1 91 0.000000005 36.7347 129
301 427 126 - MHP7448_0306 Mycoplasma hyopneumoniae 7448 83 204 0.0000003 32.2835 129
6 140 134 - MHP7448_0305 Mycoplasma hyopneumoniae 7448 1 130 0.000000003 30.9353 131
321 447 126 - MHP7448_0264 Mycoplasma hyopneumoniae 7448 129 248 0.00000000000005 36.4341 172
343 433 90 - MHP7448_0263 Mycoplasma hyopneumoniae 7448 132 221 0.0000000000009 38.4615 161
23 105 82 - MHP7448_0263 Mycoplasma hyopneumoniae 7448 20 105 0.000001 32.5581 161
349 427 78 - MHP7448_0231 Mycoplasma hyopneumoniae 7448 383 460 0.00000000006 32.9114 145
305 449 144 - MHP7448_0215 Mycoplasma hyopneumoniae 7448 237 373 1e-16 30.8219 195
23 100 77 - MHP7448_0215 Mycoplasma hyopneumoniae 7448 63 147 0.0000009 34.4444 195
307 532 225 - MHP7448_0214 Mycoplasma hyopneumoniae 7448 248 454 0.000000000000002 25.9912 185
6 67 61 - MHP7448_0210 Mycoplasma hyopneumoniae 7448 1 61 0.0000009 35.4839 109
343 427 84 - MHP7448_0024 Mycoplasma hyopneumoniae 7448 119 204 0.0000003 36.3636 114
6 96 90 - MHP7448_0024 Mycoplasma hyopneumoniae 7448 1 87 0.000003 33.6957 114
6 140 134 - MHP7448_0021 Mycoplasma hyopneumoniae 7448 1 129 0.0000001 30.1471 117
347 420 73 - MHP7448_0021 Mycoplasma hyopneumoniae 7448 126 197 0.00001 33.7838 117
6 103 97 - MHP7448_0020 Mycoplasma hyopneumoniae 7448 1 94 0.0000004 35.3535 113
6 103 97 - MHP7448_0019 Mycoplasma hyopneumoniae 7448 1 94 0.000000007 37.3737 127
348 420 72 - MHP7448_0019 Mycoplasma hyopneumoniae 7448 127 197 0.0000009 36.9863 127
318 424 106 - b4485 Escherichia coli 371 477 0.0000001 26.8519 123
297 451 154 - b4485 Escherichia coli 88 244 0.000006 22.3602 123
6 103 97 - b4485 Escherichia coli 9 108 0.00001 26.7327 123
349 441 92 - MMOB5110 Mycoplasma mobile 487 575 0.0000001 31.1828 116
7 100 93 - MMOB5100 Mycoplasma mobile 389 483 0.00000009 35.4167 117
346 432 86 - MMOB5100 Mycoplasma mobile 523 606 0.000001 31.0345 117
288 444 156 - MMOB4490 Mycoplasma mobile 502 661 7e-16 29.0123 187
329 440 111 - MMOB4480 Mycoplasma mobile 581 693 0.00000000000002 27.4336 175
316 446 130 - MMOB4330 Mycoplasma mobile 112 242 1e-17 36.5672 202
6 105 99 - MMOB4330 Mycoplasma mobile 10 113 0.0000006 26.9231 202
316 438 122 - MMOB4320 Mycoplasma mobile 130 252 3e-17 36.2903 199
7 103 96 - MMOB4320 Mycoplasma mobile 3 128 0.00000001 29.1339 199
346 559 213 - MMOB3870 Mycoplasma mobile 132 354 3e-31 35.9307 320
22 119 97 - MMOB3870 Mycoplasma mobile 19 116 5e-22 45.9184 320
349 436 87 - MMOB3520 Mycoplasma mobile 476 559 0.0000001 34.0909 117
297 448 151 - MMOB1960 Mycoplasma mobile 134 273 0.000000000003 26.3158 155
6 67 61 - MMOB1960 Mycoplasma mobile 55 116 0.000000002 40.3226 155
294 559 265 - MMOB0480 Mycoplasma mobile 197 458 <1e-50 44.7761 552
6 117 111 - MMOB0480 Mycoplasma mobile 32 142 2e-29 55.3571 552
5 133 128 - MMOB0370 Mycoplasma mobile 3 131 0.00000004 29.927 120
339 435 96 - MMOB0370 Mycoplasma mobile 394 487 0.00000008 28.866 120
341 427 86 - MMOB0140 Mycoplasma mobile 407 492 0.00000002 33.3333 122
332 425 93 - MMOB0140 Mycoplasma mobile 129 223 0.0000006 32.6316 122
338 449 111 - MMOB0100 Mycoplasma mobile 167 276 0.000000000005 30.3571 154
1 124 123 - MMOB0100 Mycoplasma mobile 27 160 0.00000005 31.6176 154
288 463 175 - MSC_0983 Mycoplasma mycoides subsp. mycoides SC 98 273 2e-17 27.2222 201
288 463 175 - MSC_0975 Mycoplasma mycoides subsp. mycoides SC 98 274 3e-18 27.2222 209
288 463 175 - MSC_0968 Mycoplasma mycoides subsp. mycoides SC 222 398 2e-18 27.2222 210
2 66 64 - MSC_0968 Mycoplasma mycoides subsp. mycoides SC 32 99 0.0000003 33.8235 210
321 449 128 - MSC_0967 Mycoplasma mycoides subsp. mycoides SC 214 345 0.0000000000002 29.5455 168
347 428 81 - MSC_0789 Mycoplasma mycoides subsp. mycoides SC 148 228 0.0000006 34.1463 111
23 100 77 - MSC_0789 Mycoplasma mycoides subsp. mycoides SC 22 104 0.0000008 38.8235 111
336 438 102 - MSC_0718 Mycoplasma mycoides subsp. mycoides SC 262 363 0.00000000000004 33.9806 173
22 113 91 - MSC_0718 Mycoplasma mycoides subsp. mycoides SC 156 248 0.00000001 34.7368 173
322 439 117 - MSC_0717 Mycoplasma mycoides subsp. mycoides SC 137 255 3e-17 34.4538 201
347 460 113 - MSC_0704 Mycoplasma mycoides subsp. mycoides SC 130 241 0.000000002 29.8246 133
6 63 57 - MSC_0704 Mycoplasma mycoides subsp. mycoides SC 5 61 0.000000006 44.8276 133
333 454 121 - MSC_0516 Mycoplasma mycoides subsp. mycoides SC 193 318 1e-22 41.2698 247
28 100 72 - MSC_0516 Mycoplasma mycoides subsp. mycoides SC 36 102 0.00000002 36.9863 247
349 449 100 - MSC_0487 Mycoplasma mycoides subsp. mycoides SC 129 227 0.0000000002 32.6733 141
25 110 85 - MSC_0487 Mycoplasma mycoides subsp. mycoides SC 3 96 0.000004 30.2083 141
349 394 45 - MSC_0435 Mycoplasma mycoides subsp. mycoides SC 517 562 0.0000003 47.8261 114
349 440 91 - MSC_0434 Mycoplasma mycoides subsp. mycoides SC 518 607 0.000000004 34.7826 130
343 436 93 - MSC_0398 Mycoplasma mycoides subsp. mycoides SC 160 253 0.000000001 32.9787 135
306 431 125 - MSC_0323 Mycoplasma mycoides subsp. mycoides SC 89 217 0.000000000007 27.907 154
318 558 240 - MSC_0224 Mycoplasma mycoides subsp. mycoides SC 105 345 <1e-50 43.6214 497
3 118 115 - MSC_0224 Mycoplasma mycoides subsp. mycoides SC 2 116 2e-25 44.8276 497
329 440 111 - MSC_0183 Mycoplasma mycoides subsp. mycoides SC 437 549 4e-18 33.6283 207
319 441 122 - MSC_0182 Mycoplasma mycoides subsp. mycoides SC 342 467 6e-16 30.9524 189
346 428 82 - MSC_0078 Mycoplasma mycoides subsp. mycoides SC 149 231 0.000000000003 37.3494 157
6 64 58 - MSC_0078 Mycoplasma mycoides subsp. mycoides SC 1 59 0.0000004 37.2881 157
310 444 134 - MSC_0030 Mycoplasma mycoides subsp. mycoides SC 210 343 0.000000000000004 31.1111 182
3 103 100 - MSC_0030 Mycoplasma mycoides subsp. mycoides SC 108 217 0.00000000005 31.8182 182
5 105 100 - MSC_0010 Mycoplasma mycoides subsp. mycoides SC 9 113 0.000000000007 37.1429 154
341 428 87 - MSC_0010 Mycoplasma mycoides subsp. mycoides SC 407 493 0.000000006 31.8182 154
2 68 66 - LIC_13431 Leptospira interrogans serovar Copenhage 10 75 0.000000002 40.2985 187
323 432 109 - LIC_13431 Leptospira interrogans serovar Copenhage 116 224 0.000000000000004 38.1818 187
319 444 125 - LIC_13385 Leptospira interrogans serovar Copenhage 120 246 2e-17 33.0709 207
307 449 142 - LIC_13384 Leptospira interrogans serovar Copenhage 113 258 0.00000000000001 26.7123 183
6 120 114 - LIC_13316 Leptospira interrogans serovar Copenhage 1 119 0.000004 26.6667 113
328 428 100 - LIC_13316 Leptospira interrogans serovar Copenhage 115 210 0.000001 29.703 113
342 430 88 - LIC_12684 Leptospira interrogans serovar Copenhage 152 239 0.0000000000002 41.573 174
6 132 126 - LIC_12684 Leptospira interrogans serovar Copenhage 28 155 0.0000000000001 30 174
7 105 98 - LIC_12526 Leptospira interrogans serovar Copenhage 3 100 3e-19 42.4242 375
310 499 189 - LIC_12526 Leptospira interrogans serovar Copenhage 98 284 5e-37 40.3061 375
7 144 137 - LIC_12428 Leptospira interrogans serovar Copenhage 12 152 0.00000002 27.2109 143
349 442 93 - LIC_12428 Leptospira interrogans serovar Copenhage 147 239 0.0000000004 36.1702 143
22 100 78 - LIC_12311 Leptospira interrogans serovar Copenhage 17 101 0.000004 27.0588 139
316 430 114 - LIC_12311 Leptospira interrogans serovar Copenhage 107 219 0.000000001 36.5217 139
320 434 114 - LIC_12295 Leptospira interrogans serovar Copenhage 116 229 0.00000005 26.087 125
300 441 141 - LIC_12182 Leptospira interrogans serovar Copenhage 470 589 0.00000000007 30.9859 149
324 440 116 - LIC_12079 Leptospira interrogans serovar Copenhage 121 246 0.000000000002 30.1587 164
3 105 102 - LIC_11858 Leptospira interrogans serovar Copenhage 2 108 0.0000000001 36.1111 214
296 449 153 - LIC_11858 Leptospira interrogans serovar Copenhage 96 241 3e-18 32.2581 214
343 445 102 - LIC_11824 Leptospira interrogans serovar Copenhage 144 241 0.00000002 31.7308 129
4 104 100 - LIC_11804 Leptospira interrogans serovar Copenhage 2 108 0.00000000004 30.8411 192
349 456 107 - LIC_11804 Leptospira interrogans serovar Copenhage 137 244 9e-16 40.367 192
27 107 80 - LIC_11544 Leptospira interrogans serovar Copenhage 24 107 0.00000000002 38.0952 172
349 445 96 - LIC_11544 Leptospira interrogans serovar Copenhage 138 233 0.0000000000002 36.0825 172
7 106 99 - LIC_11495 Leptospira interrogans serovar Copenhage 4 103 0.00000002 32.6733 129
21 139 118 - LIC_11434 Leptospira interrogans serovar Copenhage 17 129 0.000008 31.9672 106
349 427 78 - LIC_11434 Leptospira interrogans serovar Copenhage 157 231 0.000007 35.443 106
7 104 97 - LIC_11081 Leptospira interrogans serovar Copenhage 12 118 0.00000001 30.8411 170
315 410 95 - LIC_11081 Leptospira interrogans serovar Copenhage 119 213 0.0000000000003 39.5833 170
343 409 66 - LIC_10948 Leptospira interrogans serovar Copenhage 114 176 0.000002 41.791 111
349 427 78 - LIC_10675 Leptospira interrogans serovar Copenhage 156 232 0.0000009 35.443 114
348 449 101 - LIC_10671 Leptospira interrogans serovar Copenhage 143 244 0.000000000004 32.3529 160
349 438 89 - LIC_10580 Leptospira interrogans serovar Copenhage 525 611 0.00000001 33.3333 199
19 103 84 - LIC_10580 Leptospira interrogans serovar Copenhage 400 485 1e-16 48.2759 199
22 103 81 - LIC_10532 Leptospira interrogans serovar Copenhage 401 483 0.0000000002 36.9048 159
349 436 87 - LIC_10532 Leptospira interrogans serovar Copenhage 523 607 0.000000000006 36.3636 159
6 104 98 - LIC_10518 Leptospira interrogans serovar Copenhage 4 111 0.0000000001 31.5315 185
316 429 113 - LIC_10518 Leptospira interrogans serovar Copenhage 113 225 0.000000000000006 37.7193 185
1 83 82 - LIC_10351 Leptospira interrogans serovar Copenhage 1 71 0.000003 32.5301 121
340 431 91 - LIC_10351 Leptospira interrogans serovar Copenhage 122 216 0.0000001 32.6316 121
327 418 91 - LIC_10233 Leptospira interrogans serovar Copenhage 122 213 0.0000000009 33.6957 140
322 407 85 - LIC_10136 Leptospira interrogans serovar Copenhage 491 572 0.0000001 36.0465 132
22 103 81 - LIC_10136 Leptospira interrogans serovar Copenhage 394 476 0.000000007 38.0952 132
12 103 91 - MYCGA5890 Mycoplasma gallisepticum 13 108 0.000007 30.6122 102
317 437 120 - MYCGA5790 Mycoplasma gallisepticum 110 228 5e-18 39.6694 207
343 441 98 - MYCGA5780 Mycoplasma gallisepticum 166 263 0.00000000000008 36.3636 171
322 449 127 - MYCGA5180 Mycoplasma gallisepticum 183 313 0.00000000000002 29.771 175
344 440 96 - MYCGA5170 Mycoplasma gallisepticum 290 386 2e-16 35.0515 194
328 444 116 - MYCGA5140 Mycoplasma gallisepticum 203 322 0.0000000000006 27.5 163
5 145 140 - MYCGA5140 Mycoplasma gallisepticum 20 165 0.00000007 27.5641 163
328 440 112 - MYCGA5130 Mycoplasma gallisepticum 659 772 1e-17 33.3333 204
214 558 344 - MYCGA4690 Mycoplasma gallisepticum 153 496 <1e-50 50.1449 921
1 107 106 - MYCGA4690 Mycoplasma gallisepticum 3 109 <1e-50 69.1589 921
346 439 93 - MYCGA3760 Mycoplasma gallisepticum 135 228 0.00000002 27.6596 124
343 432 89 - MYCGA3660 Mycoplasma gallisepticum 489 575 0.00000001 33.3333 126
7 101 94 - MYCGA3660 Mycoplasma gallisepticum 358 453 0.000001 27.8351 126
338 459 121 - MYCGA3650 Mycoplasma gallisepticum 71 177 0.000001 27.8689 109
349 445 96 - MYCGA2850 Mycoplasma gallisepticum 150 245 0.0000000000002 39.1753 166
6 108 102 - MYCGA2850 Mycoplasma gallisepticum 10 117 0.00000001 33.0275 166
279 412 133 - MYCGA2550 Mycoplasma gallisepticum 50 195 0.0000000003 31.6129 140
6 107 101 - MYCGA2550 Mycoplasma gallisepticum 1 104 0.00000001 34.2857 140
349 456 107 - MYCGA2460 Mycoplasma gallisepticum 198 305 2e-22 43.5185 245
6 127 121 - MYCGA2460 Mycoplasma gallisepticum 5 111 0.00000000000001 34.9594 245
327 436 109 - MYCGA2190 Mycoplasma gallisepticum 128 237 0.0000000005 30 138
332 429 97 - MYCGA1030 Mycoplasma gallisepticum 125 215 0.00000002 30.6122 124
5 73 68 - MYCGA1030 Mycoplasma gallisepticum 2 72 0.0000007 33.8028 124
349 449 100 - MYCGA0410 Mycoplasma gallisepticum 223 321 0.00000000000001 35.2941 177
22 106 84 - MYCGA0410 Mycoplasma gallisepticum 94 186 0.0000000003 37.234 177
322 497 175 - MYCGA0340 Mycoplasma gallisepticum 337 517 2e-30 39.011 315
21 104 83 - MYCGA0340 Mycoplasma gallisepticum 45 128 2e-21 48.8095 315
315 408 93 - MYCGA0220 Mycoplasma gallisepticum 373 463 0.000000000003 32.9787 157
5 119 114 - MYCGA0220 Mycoplasma gallisepticum 264 389 0.000000000009 32.5397 157
7 105 98 - MYCGA0060 Mycoplasma gallisepticum 392 491 0.0000003 30.6931 114
26 103 77 - MYCGA0050 Mycoplasma gallisepticum 190 268 0.000006 35 103
3 119 116 - MYPE10280 Mycoplasma penetrans 55 185 0.00000000000001 35.1145 178
320 423 103 - MYPE10280 Mycoplasma penetrans 167 271 0.00000000000002 36.1905 178
317 437 120 - MYPE9770 Mycoplasma penetrans 121 240 0.00000000000001 33.8843 179
8 128 120 - MYPE9770 Mycoplasma penetrans 20 148 0.000003 27.907 179
335 437 102 - MYPE9760 Mycoplasma penetrans 235 339 0.00000000000001 38.6792 178
338 450 112 - MYPE9350 Mycoplasma penetrans 174 284 0.0000000000001 30.9735 171
6 105 99 - MYPE9350 Mycoplasma penetrans 39 147 0.00000009 33.6283 171
327 440 113 - MYPE8760 Mycoplasma penetrans 271 387 0.000000000000003 29.9145 184
1 78 77 - MYPE8760 Mycoplasma penetrans 16 94 0.000001 34.5679 184
327 440 113 - MYPE8750 Mycoplasma penetrans 605 719 5e-17 33.0435 199
294 558 264 - MYPE8570 Mycoplasma penetrans 280 544 <1e-50 51.3109 680
6 123 117 - MYPE8570 Mycoplasma penetrans 23 137 2e-38 60.1695 680
5 103 98 - MYPE7540 Mycoplasma penetrans 342 446 0.0000002 28.3019 116
349 442 93 - MYPE7540 Mycoplasma penetrans 486 586 0.0000003 33.6538 116
7 103 96 - MYPE7530 Mycoplasma penetrans 355 452 0.00000003 32.3232 124
347 432 85 - MYPE7530 Mycoplasma penetrans 490 572 0.0000002 32.5581 124
327 431 104 - MYPE7280 Mycoplasma penetrans 197 301 0.000001 32.381 110
347 436 89 - MYPE6610 Mycoplasma penetrans 145 234 0.000005 31.1111 104
5 103 98 - MYPE5890 Mycoplasma penetrans 99 201 0.0000008 28.5714 111
2 103 101 - MYPE5570 Mycoplasma penetrans 147 257 7e-16 37.8378 189
320 452 132 - MYPE5570 Mycoplasma penetrans 296 437 0.00000000000007 30.0699 189
305 441 136 - MYPE5530 Mycoplasma penetrans 172 307 6e-17 31.4286 199
329 440 111 - MYPE5520 Mycoplasma penetrans 678 790 1e-18 38.7931 213
7 103 96 - MYPE4100 Mycoplasma penetrans 419 516 0.00000001 33.3333 127
346 432 86 - MYPE4100 Mycoplasma penetrans 553 636 0.00000002 32.1839 127
348 436 88 - MYPE4090 Mycoplasma penetrans 494 578 0.000000008 31.4607 129
25 103 78 - MYPE4090 Mycoplasma penetrans 376 455 0.0000005 38.2716 129
332 429 97 - MYPE3630 Mycoplasma penetrans 215 311 0.000000002 33.6735 135
23 100 77 - MYPE3630 Mycoplasma penetrans 112 195 0.000002 39.2857 135
343 409 66 - MYPE3570 Mycoplasma penetrans 152 214 0.000004 38.806 105
343 435 92 - MYPE3560 Mycoplasma penetrans 201 291 0.0000001 31.1828 118
332 427 95 - MYPE3490 Mycoplasma penetrans 216 310 0.00000000000006 36.0825 173
21 103 82 - MYPE3490 Mycoplasma penetrans 112 200 0.000000000001 38.2022 173
294 436 142 - MYPE3080 Mycoplasma penetrans 142 293 0.000000000002 27.6316 160
319 431 112 - MYPE3030 Mycoplasma penetrans 474 585 0.000000007 28.3186 129
7 115 108 - MYPE2480 Mycoplasma penetrans 406 509 0.00000002 33.3333 126
7 103 96 - MYPE2470 Mycoplasma penetrans 351 450 0.0000000006 36.6337 138
349 432 83 - MYPE2470 Mycoplasma penetrans 490 570 0.000003 34.1176 138
343 427 84 - MYPE1880 Mycoplasma penetrans 129 209 0.0000006 32.9412 112
346 428 82 - MYPE960 Mycoplasma penetrans 185 266 0.000000003 33.7209 132
315 430 115 - Mycoplasma pulmonis 175 286 0.0000000000008 34.4828 162
6 103 97 - Mycoplasma pulmonis 67 173 0.00000000009 31.7757 162
326 408 82 - Mycoplasma pulmonis 436 520 0.000003 36.3636 105
6 64 58 - Mycoplasma pulmonis 1 58 0.000001 38.9831 109
346 502 156 - Mycoplasma pulmonis 164 323 9e-28 40.9938 291
22 119 97 - Mycoplasma pulmonis 51 148 7e-20 43.8776 291
292 428 136 - Mycoplasma pulmonis 111 212 0.0000000003 29.927 139
6 121 115 - Mycoplasma pulmonis 3 122 0.00000003 29.7521 139
349 444 95 - Mycoplasma pulmonis 134 221 0.0000002 35.4167 115
6 64 58 - Mycoplasma pulmonis 1 58 0.000003 38.9831 115
25 68 43 - Mycoplasma pulmonis 22 65 0.000003 40.9091 106
349 450 101 - Mycoplasma pulmonis 317 418 1e-20 40.1961 230
21 121 100 - Mycoplasma pulmonis 27 122 0.000000000003 37.2549 230
294 558 264 - Mycoplasma pulmonis 186 446 <1e-50 48.6792 570
2 113 111 - Mycoplasma pulmonis 15 125 3e-29 54.4643 570
286 439 153 - Mycoplasma pulmonis 216 373 0.000000000000005 28.75 181
6 68 62 - Mycoplasma pulmonis 46 111 0.0000005 36.3636 181
315 504 189 - Mycoplasma pulmonis 272 450 0.000000000000005 28.2051 181
317 455 138 - Mycoplasma pulmonis 129 278 0.000000000000003 35.0993 183
316 439 123 - Mycoplasma pulmonis 103 226 0.00000000000005 32.8 172
22 123 101 - Mycoplasma pulmonis 18 122 0.0000002 28.5714 172
343 425 82 - Mycoplasma pulmonis 411 492 0.000000006 34.9398 128
2 103 101 - Mycoplasma pulmonis 4 109 0.00000001 28.972 128
326 450 124 - Mycoplasma pulmonis 600 725 8e-17 26.9841 196
321 444 123 - Mycoplasma pulmonis 148 274 0.000000000000001 29.9213 186
324 430 106 - Mycoplasma pulmonis 123 229 0.000000003 29.9065 131
343 431 88 - Mycoplasma pulmonis 130 217 0.0000002 32.5843 116
334 497 163 - Mycoplasma pulmonis 277 443 4e-30 38.9222 311
2 111 109 - Mycoplasma pulmonis 31 140 2e-28 46.3636 311
349 420 71 - Mycoplasma pulmonis 134 203 0.000001 43.2432 109
6 101 95 - Mycoplasma pulmonis 1 98 0.00000005 32.3232 120
280 381 101 - Mycoplasma pulmonis 64 165 0.00000007 33.0097 120
303 496 193 - Mycoplasma pulmonis 320 529 5e-34 40.1869 345
7 105 98 - Mycoplasma pulmonis 33 130 6e-22 46.4646 345
347 428 81 - MG468.1 Mycoplasma genitalium 187 267 0.00000000001 36.5854 150
26 104 78 - MG468.1 Mycoplasma genitalium 75 159 0.000000001 40 150
External IDs
COG
COG3842E
EC number
3.6.3.31
Gene ID
876902
GI
13507794
GO
Amino acid transport and metabolism
Home COG
E
InterPro
IPR003439|ABC Transporter related
InterPro
IPR010989|t-snare
InterPro
IPR008995|Molybdate/tungstate binding
InterPro
IPR013611|Transport-associated OB
InterPro
IPR003593|AAA ATPase
Old MP number
MP099
Pathway
polyamine transport
Pathway
Transporter, ABC superfamily
PDB homologs
1g29_1
PDB homologs
1q12_A
PDB homologs
1q1b_A
Pfam
PF08402
Pfam
PF00485
Pfam
PF03215
Pfam
PF00693
Pfam
PF00005
PID
g1673754
RefSeq
NP_109743.1
Swiss-Prot protein ID
POTA_MYCPN
phylomeDB tree
POTA_MYCPN
UniProt
P75059
Transcription
IMAGE BROWSERS

OPERON OP22 (Genomic Overview)
Region:70382-75203

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn055STRING legend

PDB image(s)

1g29

PDB 1g29

1q12

PDB 1q12

1q1b

PDB 1q1b