Gene mpn052 (MPN052)
Name
mpn052
Stable ID
MPN052
Location
64831 - 66804 +
Sequence
    1  ATGTTTGGAA AAGGGTTGGT CAAAAAAAGC CTTTTATTTT TTAGTGGCGT GAGTACTATG
   61  GCCGTCTTTT TAGTGTCTTG TGGTGCTACT AGAATTTGGG AATCTTCGAT TCAACTGTTA
  121  GTTTCCAATG ATGAAGCTAC ATTAGCTGAC AAATCCTTTT CTGAGATGTC CTATGAAGGG
  181  ATTAGAAGGT ACTTTAGATC TCAAAAACAT ATTGAATTAC CATCACCAAA TAGTTCCCTG
  241  TTACAAGACG GCAACGGCCT TTGAAAACGT CCCGGACGTA CTTTAAGTGA TCGGATTGCT
  301  ACCTTTAAAA ACATTAAGAA CGATGGTAGT GATGTGATTG TAGCTACTGG ATTTAACCAA
  361  CAAGAAGCAC TACAAGCAAT TAGCTCTGAT GACCGTCGTT ATTTAGCTGA TAAAAACGAC
  421  CTTGCTAAAG TTGGTTTCAT TTTTGTCGAT GGCCAAATTG AAAAGGAATA TAACGTGATT
  481  AATAAAACGC CACAATTTAG ATCAACCCCA CTAAACATTT CATCCGTTGC CTTCCGCAGT
  541  GATGATGGTT CCTTCTTAAC TGGAGTAGCA ACTGCAGTTT ATTTGAATTT AAATCAAGAT
  601  TACTTTTTAA AGAAGAATGG AGCAACCAAT AATAGTAGCC AAGATTTAAC CGTTTCTGGT
  661  TTTGTCGGTG TTCCTATTCC TTCAACCCTT TCTTTTTTAA ACGGTTTCCG TTTGGGCATT
  721  GCTTATTTTA ATGAGGTGAT TTACACCCAT TTAAGTGATG CTGAAACAAC ATCTGATAAC
  781  AAGAGTAATT CTTCAAGTGC TAGCAACTCT GTTTTAGTGC AACTTAAACA GATGCAAGGA
  841  AACGACAAAA AGATTAAAAA GATTAAATGG ATATCTCCTA AACAAGGAAG CGATAATAAT
  901  TCGAACCTCA GTATCGATGA TCACAAGTCT GGTTCTTTCT CCAGCACTGA ACCACGAGCA
  961  ACAACTATCA TTAATAATCT TTTAGACAAG GGTGTGAGTG CCATTATTCC TGTTGCCGGA
 1021  CCGCAAGTAA ACTTAGCAGT TAACGAGGTG GCACGTCGCA AAGCGCACAC TGCTATTATT
 1081  GGTGTTGATA GTGCGCAAGA ATTATTAGAT ATTAACCAAG ATGCACCTGA TAAAGATCAG
 1141  TTAATCAAAG GTAATAAAAA AATTATTCCT TTCTCTTCTA TTAAAGCCTT GGATGTTGCC
 1201  ATTGAAAACA TGTTGATTGC CATTCAAAAA GGCAGTGATA ATAATGGATA TAAAGGATTT
 1261  GGTTATAACA ACATTGGTAC GGTTGGAACT AGTTCAGTAG GTATTAGTGA GGCTGGTTAT
 1321  GAATTCTTAA TTGATCCAGT TTTTTGAAAG ACTACTCAGT CACAAGGGAA ATCTATGGCC
 1381  ACAAATATGA CTAATTTAAA ACGTTTATCA TCTGATGATA CAAACACTAA GAAAGCATTA
 1441  AAAGAGGTAA GCACCCATAA AAATGGTAGT GATAAAGATG GGATTATTGG TAAATATTCC
 1501  AATTTATTAA CTAAAAAAAG CACAACAGTA ACTGCTGTTG CTCAAAAATC TATGACAGAC
 1561  AATAATAGTG GAACTGAGCA AAAAAAGAAT CTTTCTGAAG TAGATACTAA GAAGAAAGAG
 1621  AAAGAAAGTA AAGGTAAAAC TCAAAGTAAT GGTCAGGACA GTGGCCAACA AAACGGAAAA
 1681  GAAACAAACG ATATTATTTC TAAGTATTCT AAGCTGTTAA CTATGACAAC TATGAACAAT
 1741  AAAGTAATGT CATCTAAAAA ACAAAGTAGC GATGATAACA GTTTTAAAAA GACTTCAGAA
 1801  AACGGAGACT GAGTAATTAA AGGAGACGAG TTAACTAAGA AAAAATCAAC TGAGCTTCCT
 1861  GCTTTTGCTA AAGGTGCAGA TTACCCTACT TTCCCTACAG AAGCGGTAAG CGTTATTAAC
 1921  GGAAGTACCG CTTTAGACGG CAAAGGTTTT AAGTGGAGCT TTAAACAAAT TTAA
Download Sequence
Operon
OP20
Operon location
64803 - 67250
Protein (mpn052)
Name
Uncharacterized lipoprotein MPN_052
Stable ID
Mpn052
Molecular Weight
72270
Isoelectric Point
10
Localization
LIPOP
Comment ABC transporter substrate binding component? Belongs to a family of basic membrane proteins (BMP), outer membrane proteins that produce an immune response when expressed by pathogenic strains in a host (J Bacteriol, 2003, 185:2538)
Sequence
MFGKGLVKKSLLFFSGVSTMAVFLVSCGATRIWESSIQLLVSNDEATLADKSFSEMSYEGIRRYFRSQKHIELPSPNSSL
LQDGNGLWKRPGRTLSDRIATFKNIKNDGSDVIVATGFNQQEALQAISSDDRRYLADKNDLAKVGFIFVDGQIEKEYNVI
NKTPQFRSTPLNISSVAFRSDDGSFLTGVATAVYLNLNQDYFLKKNGATNNSSQDLTVSGFVGVPIPSTLSFLNGFRLGI
AYFNEVIYTHLSDAETTSDNKSNSSSASNSVLVQLKQMQGNDKKIKKIKWISPKQGSDNNSNLSIDDHKSGSFSSTEPRA
TTIINNLLDKGVSAIIPVAGPQVNLAVNEVARRKAHTAIIGVDSAQELLDINQDAPDKDQLIKGNKKIIPFSSIKALDVA
IENMLIAIQKGSDNNGYKGFGYNNIGTVGTSSVGISEAGYEFLIDPVFWKTTQSQGKSMATNMTNLKRLSSDDTNTKKAL
KEVSTHKNGSDKDGIIGKYSNLLTKKSTTVTAVAQKSMTDNNSGTEQKKNLSEVDTKKKEKESKGKTQSNGQDSGQQNGK
ETNDIISKYSKLLTMTTMNNKVMSSKKQSSDDNSFKKTSENGDWVIKGDELTKKKSTELPAFAKGADYPTFPTEAVSVIN
GSTALDGKGFKWSFKQI
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation SFSEmSYEGIR 52 63 M
Oxidation ALDVAIENmLIAIQK 396 411 M
Oxidation LLTMTTmNNK 572 582 M
Oxidation LLTmTTmNNK 572 582 M
Oxidation LLTmTTMNNK 572 582 M
GENE/PROTEIN mpn052 (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-27 PS51257 (n.a.) NULL 0
37-397 PF02608 (IPR003760) Basic membrane lipoprotein Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008289'>'lipid' == '' ? '': 'lipid'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0008289)

0
46-193 G3DSA:3.40.50.2300 (n.a.) NULL 0.000000015
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
12 452 440 - MYCGA5980 Mycoplasma gallisepticum 14 406 <1e-50 39.6018 706
1 500 499 - MG040 Mycoplasma genitalium 5 504 <1e-50 66.3386 1694
562 657 95 - MG040 Mycoplasma genitalium 496 591 4e-17 49.4845 1694
1 520 519 - MYPE5900 Mycoplasma penetrans 2 501 <1e-50 36 769
External IDs
COG
COG1744R
Gene ID
876850
GI
13507791
GO
Function unknown
Home COG
S
InterPro
IPR003760|Basic membrane lipoprotein
Old MP number
MP102
Pathway
Membrane associated
Pfam
MPN052
PID
g1673758
RefSeq
NP_109740.1
Swiss-Prot protein ID
Y052_MYCPN
phylomeDB tree
Y052_MYCPN
UniProt
P75062
Transcription
IMAGE BROWSERS

OPERON OP20 (Genomic Overview)
Region:64803-67250

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn052STRING legend