Gene msbA (MPN019)
Name
msbA
Stable ID
MPN019
Location
21108 - 23012 +
Sequence
    1  ATGCTAAGCT CATGCAGAGC TGTGACATCT ATGTCAAGAT GAAGCAAGCA CAAAAAGACC
   61  AAGGAGGTGA TTTCGATGCT GTCGCATAAC CAAAAACCCA ATTCCTGGAA GATTTTGTGA
  121  CGTTTAATTA AGTCCGTGCA AGGTCGCACT TCCTCCAAGG TGCTGTATGT CATGGTCTGT
  181  GCCATCTTTG GTATTCTCAC TGGGGTTACT AACTCGATTC TCTTGGCCCA GGGCCTGGGT
  241  TTTATTTTTC CTACCACTAA TACCGAAACT GATGGTATCC AATCAGTGTA CTTACTGGTA
  301  TTTGCGCACA ACTTACCGGT CATGGAGCGC TTGACGATTG TTTGTGTTAC CGTGGTTGTG
  361  GCTTACATTC TCATCTTTAG TTTTAACGTA GCGCAGAACT ATTTAGGTTT AAAGCTGTAC
  421  CAAGAGATCT GTGCCTTGTT GCGCTGAAAG GCTTACCTCA AGATTCAAAG TATGTCCACT
  481  AGTTTCTTTG ATACGCAGAA CAACGGGGAT TTAATGAGTC GCTTGACCAA CGACGTTTAC
  541  AACATTAACA ACCTGTATGC CCAAGTGGGT GGACAGACAA TTCAGAGTTT GTTTATCTTA
  601  ATGACAACAG CGACGATTCT GTTTGTTTTA AGTCCAGTCA TTGCCTTAAT TTCGCTAACA
  661  GTCTTAATTG CTTTAATTGC CCTTTCCTTT CTCTTTTTAA AGAAGGCACG CGCTGCTTAT
  721  GCAAAGGTGC AAAACAACTT AGGGGACATG TCGGGTTACA TTGAAGAAGT GTTGTCGAAC
  781  CATAAGGTAG TTCATGTCTT GAAACTGCAA GAGGTGATGA TTGATAACTT TGACAAGTAC
  841  AACCGCCCGA TGGTTAATCC CACCATTAAG GCCAATACCT ATGCGGTGTT TATTTACTCC
  901  TGGTTTGGTT TTATTTCCAA TATTACTTAC TTAGCTTCGA TCTCAATTGC CACGGCCTTT
  961  AGTGTGAATA ACATTCCCTC CTTTGGGGTG AGTGCGATTA ACTATTCGTT TATGCTGTCT
 1021  TACATTGCGG CCTTACGTCA AACAGCACTC CCTTTAAACC AGATCTTTAG CTTGTGAAAC
 1081  TTAATCCAGT TAGGGATAGT AAGTGGCGAG AGGGTCTTCA AGATCTTGGA TCTAGAAAGT
 1141  CCCCAAAAAC AGGCCACCAT TACTAAGTTA CCCAACATTA AGGGCAACAT CCGTTTTGAA
 1201  AAGGTAGTTT TTGGTTACAG TGCGGACAAA CCAATTTTAA CGGGGATTGA TTTCTCGGTT
 1261  AAACACGGTG ACATTGTGGC CATAGTCGGT CCTACTGGAG CGGGTAAGTC CACCATTATT
 1321  AACCTGTTGA TGAAGTTCTA CAAACCGTTT GCTGGGAAGA TCTACATGGA CAACTTTGAG
 1381  ATTAGTGAGG TGAGTGAAAC TGCTTGACGG GAAAAGATTT CGATTGTGCT CCAAGACCCC
 1441  TTCTTGTTTA GTGGCACGAT TAAGGAAAAC ATCCGCATGG GACGGCAAGA TGCCACTGAT
 1501  GAGGAAATTA TAGAGGCGTG CAAGGTGGCC AATGCTCATG ACTTTATTAT GCGTTTACCC
 1561  CAAGGTTACA ACACCTTTAT TTCCAACAAA ACTGATTATC TCTCGGTCGG TGAGCGCCAA
 1621  CTGTTAACTA TTGCCCGCGC TGTTATTCGT AATGCCCCGG TGTTATTATT GGATGAAGCC
 1681  ACGAGCTCCA TCGATGTACA CTCCGAAAAA TTGATCCAAC AATCAATAGG CAGACTAATG
 1741  AAGGATAAAA CATCGTTTAT AATATCCCAT CGACTCTCAA TCATCCGTAA TGCGACGCTG
 1801  ATAATTGTGA TTAATGATGG AAAAGTTTTG GAAATGGGTA ACCATGAACA ATTAATGCGG
 1861  CAAAACGGTT TTTATGCTCG ATTAAAGCGC TCTGCTGTGA AGTAA
Download Sequence
Operon
OP8
Operon location
19314 - 29803
Protein (mpn019)
Name
Putative ABC transporter ATP-binding protein MPN_019
Stable ID
Mpn019
Molecular Weight
69740
Isoelectric Point
10
Localization
TMHMM 
Comment transport ATP-binding protein;an Essential ABC Family Transporter, in Lipid and Phospholipid Biosynthesis; 5 TM helices
Sequence
MLSSCRAVTSMSRWSKHKKTKEVISMLSHNQKPNSWKILWRLIKSVQGRTSSKVLYVMVCAIFGILTGVTNSILLAQGLG
FIFPTTNTETDGIQSVYLLVFAHNLPVMERLTIVCVTVVVAYILIFSFNVAQNYLGLKLYQEICALLRWKAYLKIQSMST
SFFDTQNNGDLMSRLTNDVYNINNLYAQVGGQTIQSLFILMTTATILFVLSPVIALISLTVLIALIALSFLFLKKARAAY
AKVQNNLGDMSGYIEEVLSNHKVVHVLKLQEVMIDNFDKYNRPMVNPTIKANTYAVFIYSWFGFISNITYLASISIATAF
SVNNIPSFGVSAINYSFMLSYIAALRQTALPLNQIFSLWNLIQLGIVSGERVFKILDLESPQKQATITKLPNIKGNIRFE
KVVFGYSADKPILTGIDFSVKHGDIVAIVGPTGAGKSTIINLLMKFYKPFAGKIYMDNFEISEVSETAWREKISIVLQDP
FLFSGTIKENIRMGRQDATDEEIIEACKVANAHDFIMRLPQGYNTFISNKTDYLSVGERQLLTIARAVIRNAPVLLLDEA
TSSIDVHSEKLIQQSIGRLMKDKTSFIISHRLSIIRNATLIIVINDGKVLEMGNHEQLMRQNGFYARLKRSAVK
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation STIINLLmK 437 446 M
Oxidation STIINLLmk 437 446 M
GENE/PROTEIN msbA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
9-628 PTHR19242:SF91 (n.a.) NULL 0
9-628 PTHR19242 (n.a.) NULL 0
30-381 SSF90123 (IPR011527) ABC transporter, transmembrane domain, type 1 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006810'>'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0006810) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0055085'>'transmembrane' == '' ? '': 'transmembrane'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0055085)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016021'>'integral' == '' ? '': 'integral'; 'to' == '' ? '': 'to'; 'membrane' == '' ? '': 'membrane'; ('GO' == '' ? '': 'GO';:0016021)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity';

0
37-379 G3DSA:1.20.1560.10 (n.a.) NULL 0
54-345 PF00664 (IPR001140) ABC transporter, transmembrane domain Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006810'>'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0006810) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0055085'>'transmembrane' == '' ? '': 'transmembrane'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0055085)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016021'>'integral' == '' ? '': 'integral'; 'to' == '' ? '': 'to'; 'membrane' == '' ? '': 'membrane'; ('GO' == '' ? '': 'GO';:0016021)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity';

4.3e-38
57-364 PS50929 (IPR017940) ABC transporter integral membrane type 1 0
376-617 SSF52540 (n.a.) NULL 0
397-625 G3DSA:3.40.50.300 (n.a.) NULL 0
397-631 PS50893 (IPR003439) ABC transporter-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

0
422-608 SM00382 (IPR003593) ATPase, AAA+ type, core Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000166'>'nucleotide' == '' ? '': 'nucleotide'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000166) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0017111'>'nucleoside' == '' ? '': 'nucleoside';-'triphosphatase' == '' ? '': 'triphosphatase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0017111)

0.000000000000034
437-562 PF00005 (IPR003439) ABC transporter-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

2.4e-19
534-548 PS00211 (IPR017871) ABC transporter, conserved site Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
142 630 488 - b0914 Escherichia coli 95 577 <1e-50 31.2253 605
161 625 464 - b0449 Escherichia coli 114 568 <1e-50 28.8172 527
112 630 518 - b0448 Escherichia coli 62 569 <1e-50 26.8061 490
396 631 235 - b0886 Escherichia coli 338 572 5e-35 31.6456 359
364 628 264 - b0887 Escherichia coli 318 580 9e-32 28.1955 331
418 619 201 - b0066 Escherichia coli 20 218 3e-20 30.0971 232
397 619 222 - b4287 Escherichia coli 3 226 3e-17 26.8085 206
412 613 201 - b1917 Escherichia coli 18 226 4e-17 30.5556 204
412 621 209 - b0262 Escherichia coli 21 227 1e-16 26.8182 200
397 616 219 - b3463 Escherichia coli 2 222 3e-16 28.8793 197
405 604 199 - b0490 Escherichia coli 14 210 3e-16 27.4038 197
412 620 208 - b0809 Escherichia coli 16 225 5e-16 27.7273 195
413 619 206 - b1483 Escherichia coli 32 231 7e-16 27.027 194
412 609 197 - b1117 Escherichia coli 24 223 9e-16 28.2297 193
410 613 203 - b1126 Escherichia coli 30 230 0.000000000000001 26.6355 192
418 619 201 - b2677 Escherichia coli 49 253 0.000000000000001 28.5714 192
412 610 198 - b0879 Escherichia coli 23 222 0.000000000000003 27.2727 189
416 618 202 - b0855 Escherichia coli 38 237 0.000000000000004 26.4423 188
413 611 198 - b0199 Escherichia coli 21 221 0.000000000000005 29.6804 187
167 617 450 - b2211 Escherichia coli 103 535 0.000000000000008 21.9149 185
416 618 202 - b0829 Escherichia coli 35 256 0.000000000000008 27.3128 185
358 613 255 - b0829 Escherichia coli 269 546 0.00000000005 26.2069 185
396 613 217 - b3450 Escherichia coli 3 217 0.00000000000004 22.2707 179
412 620 208 - b0151 Escherichia coli 26 237 0.0000000000002 24.6637 173
413 618 205 - b3540 Escherichia coli 38 249 0.0000000000002 26.6376 173
413 618 205 - b3725 Escherichia coli 26 239 0.0000000000003 29.4643 171
412 618 206 - b1513 Escherichia coli 26 227 0.0000000000003 29.3839 171
413 601 188 - b4485 Escherichia coli 25 224 0.0000000000004 28.0952 170
408 618 210 - b3479 Escherichia coli 14 228 0.0000000000005 27.9476 169
393 609 216 - b2547 Escherichia coli 14 227 0.0000000000006 27.2321 169
405 611 206 - b3480 Escherichia coli 20 232 0.0000000000007 24.5536 168
396 619 223 - b0588 Escherichia coli 7 232 0.000000000001 23.2068 167
413 608 195 - b1900 Escherichia coli 23 220 0.000000000002 28.7805 164
417 613 196 - b4524 Escherichia coli 22 217 0.000000000002 25.3589 164
408 611 203 - b0366 Escherichia coli 12 211 0.000000000003 26.3158 163
416 622 206 - b0794 Escherichia coli 348 550 0.000000000004 26.0465 162
409 618 209 - b0794 Escherichia coli 19 224 0.0000002 23.9437 162
397 618 221 - b1441 Escherichia coli 5 222 0.000000000006 24.2553 160
412 611 199 - b3271 Escherichia coli 27 227 0.000000000007 24.537 159
413 607 194 - b4087 Escherichia coli 21 221 0.000000000009 28.5024 159
399 561 162 - b3454 Escherichia coli 8 165 0.00000000003 30.1205 155
412 613 201 - b2180 Escherichia coli 301 508 0.00000000006 26.9406 152
386 611 225 - b2180 Escherichia coli 4 237 0.0000000006 25.0996 152
416 614 198 - b1290 Escherichia coli 33 234 0.0000000001 23.2558 149
413 614 201 - b0864 Escherichia coli 18 224 0.0000000001 26.2443 148
406 609 203 - b0933 Escherichia coli 20 211 0.0000000002 24.5192 148
397 614 217 - b2129 Escherichia coli 2 218 0.0000000002 22.7679 147
402 599 197 - b1858 Escherichia coli 12 188 0.0000000004 26.1084 144
416 618 202 - b4035 Escherichia coli 22 221 0.0000000006 24.0385 143
412 566 154 - b1756 Escherichia coli 16 166 0.0000000007 28.9308 142
412 621 209 - b2422 Escherichia coli 17 227 0.000000001 24.2009 140
416 623 207 - b3486 Escherichia coli 295 499 0.000000002 25 139
415 618 203 - b1247 Escherichia coli 42 252 0.000000002 22.5225 138
405 613 208 - b1484 Escherichia coli 17 239 0.000000009 23.9496 133
416 618 202 - b0765 Escherichia coli 17 216 0.00000001 25.1185 132
408 609 201 - b4391 Escherichia coli 334 520 0.00000001 28.5714 131
411 607 196 - b3749 Escherichia coli 266 471 0.00000001 24.7619 131
413 608 195 - b3749 Escherichia coli 20 218 0.00000002 29.902 131
396 621 225 - b1246 Escherichia coli 21 259 0.00000001 23.7154 131
423 608 185 - b3567 Escherichia coli 30 219 0.00000001 28.6432 131
391 609 218 - b3567 Escherichia coli 251 483 0.0000003 22.8216 131
408 630 222 - b2306 Escherichia coli 16 250 0.00000002 27.0916 130
395 633 238 - b0949 Escherichia coli 316 541 0.00000003 27.0161 128
408 619 211 - b0949 Escherichia coli 14 242 0.00000006 24.8927 128
416 614 198 - b3541 Escherichia coli 26 237 0.00000003 26.2443 128
288 583 295 - b1496 Escherichia coli 263 532 0.00000004 23.5294 127
408 619 211 - b1709 Escherichia coli 11 221 0.00000008 25 125
416 613 197 - b4097 Escherichia coli 24 228 0.0000001 25.2336 123
409 614 205 - b1682 Escherichia coli 13 229 0.0000003 25.7778 119
412 611 199 - b0495 Escherichia coli 25 226 0.0000004 25.1185 119
429 611 182 - b0652 Escherichia coli 33 216 0.0000008 24.3523 116
409 578 169 - b2201 Escherichia coli 15 173 0.000001 24.1176 115
411 623 212 - b0820 Escherichia coli 333 528 0.000003 22.3744 111
151 632 481 - MARTH_orf684 Mycoplasma arthritidis 130 613 <1e-50 36.2887 763
255 628 373 - MARTH_orf685 Mycoplasma arthritidis 209 587 <1e-50 31.1224 457
397 613 216 - MARTH_orf376 Mycoplasma arthritidis 2 218 3e-18 31.1111 209
413 614 201 - MARTH_orf864 Mycoplasma arthritidis 87 296 0.000000000000004 28.3721 182
412 609 197 - MARTH_orf119 Mycoplasma arthritidis 89 286 0.000000000001 23.8095 160
308 590 282 - MARTH_orf637 Mycoplasma arthritidis 396 661 0.00000000001 27.3356 152
379 629 250 - MARTH_orf625 Mycoplasma arthritidis 34 283 0.0000000003 24.3346 140
409 614 205 - MARTH_orf575 Mycoplasma arthritidis 30 225 0.0000000004 27.0531 138
377 618 241 - MARTH_orf400 Mycoplasma arthritidis 21 290 0.00000001 24.5487 125
418 521 103 - MARTH_orf836 Mycoplasma arthritidis 52 156 0.00000008 26.1682 119
413 480 67 - MARTH_orf399 Mycoplasma arthritidis 31 103 0.0000002 34.2466 115
416 610 194 - MARTH_orf821 Mycoplasma arthritidis 22 219 0.000001 26.1905 109
132 634 502 - MAG5990 Mycoplasma agalactiae 102 610 <1e-50 36.5949 804
20 634 614 - MAG3100 Mycoplasma agalactiae 2 604 <1e-50 28.9348 679
367 634 267 - MAG3110 Mycoplasma agalactiae 327 593 8.99999e-40 33.9483 394
152 634 482 - MAG6000 Mycoplasma agalactiae 114 593 6e-36 24.3408 361
397 619 222 - MAG5180 Mycoplasma agalactiae 2 224 0.000000000000001 26.383 186
416 625 209 - MAG0290 Mycoplasma agalactiae 1 206 0.000000001 24.3243 134
389 494 105 - MAG1250 Mycoplasma agalactiae 7 107 0.000000002 32.7103 133
412 609 197 - MAG7430 Mycoplasma agalactiae 139 336 0.00000005 21.5311 120
412 619 207 - MAG0350 Mycoplasma agalactiae 113 336 0.00000005 22.9787 120
416 610 194 - MAG0140 Mycoplasma agalactiae 25 224 0.00000006 27.7512 120
397 620 223 - MAG0140 Mycoplasma agalactiae 264 512 0.0000001 26.4368 120
416 624 208 - MAG5170 Mycoplasma agalactiae 26 258 0.0000001 22.5 117
413 480 67 - MAG1040 Mycoplasma agalactiae 30 102 0.0000003 27.3973 113
406 565 159 - MAG4610 Mycoplasma agalactiae 14 166 0.000002 26.6272 106
412 609 197 - MCJ_007200 Mycoplasma conjunctivae 20 209 2e-18 31.3725 211
397 622 225 - MCJ_004670 Mycoplasma conjunctivae 2 228 7e-16 26.0504 188
412 609 197 - MCJ_004660 Mycoplasma conjunctivae 84 281 0.000000000000007 29.9065 180
387 593 206 - MCJ_002480 Mycoplasma conjunctivae 301 507 0.00000000000003 27.2727 175
412 590 178 - MCJ_000740 Mycoplasma conjunctivae 20 189 0.00000000000005 27.957 172
397 605 208 - MCJ_000450 Mycoplasma conjunctivae 4 224 0.00000000000006 27.3543 171
409 593 184 - MCJ_002490 Mycoplasma conjunctivae 333 510 0.0000000000009 26.738 161
389 618 229 - MCJ_002400 Mycoplasma conjunctivae 4 245 0.0000000003 25.098 140
408 494 86 - MCJ_005870 Mycoplasma conjunctivae 22 107 0.00000006 31.8182 120
524 617 93 - MCJ_000760 Mycoplasma conjunctivae 74 168 0.00000008 31.5789 119
413 481 68 - MCJ_002410 Mycoplasma conjunctivae 24 97 0.00000008 31.0811 119
534 613 79 - MCJ_002410 Mycoplasma conjunctivae 617 699 0.000004 32.5301 119
416 610 194 - MCJ_007040 Mycoplasma conjunctivae 26 222 0.0000005 29.3532 112
418 621 203 - MCJ_000370 Mycoplasma conjunctivae 28 226 0.000001 25.8065 108
406 624 218 - MCJ_004680 Mycoplasma conjunctivae 12 251 0.000003 24.5059 106
417 483 66 - MCJ_000160 Mycoplasma conjunctivae 53 117 0.000003 31.3433 105
389 632 243 - MCAP_0538 Mycoplasma capricolum subsp. capricolum 370 617 <1e-50 40.1606 452
392 633 241 - MCAP_0537 Mycoplasma capricolum subsp. capricolum 362 615 1.99993e-41 36.2205 410
412 621 209 - MCAP_0202 Mycoplasma capricolum subsp. capricolum 20 226 8e-19 28.2407 214
411 607 196 - MCAP_0021 Mycoplasma capricolum subsp. capricolum 130 325 0.0000000000002 26.57 167
413 618 205 - MCAP_0189 Mycoplasma capricolum subsp. capricolum 20 222 0.000000000003 21.2963 157
413 592 179 - MCAP_0483 Mycoplasma capricolum subsp. capricolum 38 224 0.00000000001 25.7576 151
397 613 216 - MCAP_0668 Mycoplasma capricolum subsp. capricolum 140 356 0.00000000003 24.5536 148
396 614 218 - MCAP_0667 Mycoplasma capricolum subsp. capricolum 6 234 0.00000000005 25.7511 147
416 608 192 - MCAP_0037 Mycoplasma capricolum subsp. capricolum 31 226 0.0000000005 30.1508 138
412 610 198 - MCAP_0730 Mycoplasma capricolum subsp. capricolum 21 228 0.0000000005 24.2009 138
416 610 194 - MCAP_0655 Mycoplasma capricolum subsp. capricolum 24 210 0.00000002 25.8883 125
416 613 197 - MCAP_0797 Mycoplasma capricolum subsp. capricolum 24 217 0.0000005 24.2718 112
382 619 237 - MCAP_0119 Mycoplasma capricolum subsp. capricolum 53 310 0.000001 21.1896 110
534 618 84 - MCAP_0164 Mycoplasma capricolum subsp. capricolum 454 541 0.000002 35.2273 107
410 610 200 - MCAP_0826 Mycoplasma capricolum subsp. capricolum 15 231 0.000003 22.4771 105
407 609 202 - MCAP_0123 Mycoplasma capricolum subsp. capricolum 13 234 0.000004 25.6522 105
147 632 485 - MYCGA0060 Mycoplasma gallisepticum 113 627 <1e-50 33.0754 710
110 633 523 - MYCGA3660 Mycoplasma gallisepticum 69 594 <1e-50 28.6517 561
286 530 244 - MYCGA0050 Mycoplasma gallisepticum 51 303 2e-21 29.8507 236
397 624 227 - MYCGA5790 Mycoplasma gallisepticum 8 233 4e-19 27.7056 217
410 621 211 - MYCGA0410 Mycoplasma gallisepticum 92 311 5e-16 29.4372 190
414 601 187 - MYCGA5890 Mycoplasma gallisepticum 26 218 0.000000000000003 34.5178 183
383 620 237 - MYCGA5890 Mycoplasma gallisepticum 284 536 0.0000000008 24.9012 183
412 616 204 - MYCGA0220 Mycoplasma gallisepticum 284 488 0.00000000000001 26.3889 179
454 628 174 - MYCGA3650 Mycoplasma gallisepticum 2 176 0.00000000000003 26.8571 175
409 593 184 - MYCGA2550 Mycoplasma gallisepticum 13 193 0.00000000000007 29.8429 171
378 618 240 - MYCGA2850 Mycoplasma gallisepticum 1 236 0.00000000007 26.2948 146
413 618 205 - MYCGA5780 Mycoplasma gallisepticum 42 258 0.00000000008 27.1493 145
410 614 204 - MYCGA2770 Mycoplasma gallisepticum 16 228 0.0000000008 28.4404 136
416 617 201 - MYCGA1030 Mycoplasma gallisepticum 25 221 0.00000007 23.2227 120
534 620 86 - MYCGA5130 Mycoplasma gallisepticum 681 770 0.0000002 34.0426 116
413 491 78 - MYCGA0340 Mycoplasma gallisepticum 47 124 0.0000005 31.25 112
411 627 216 - MYCGA3760 Mycoplasma gallisepticum 22 234 0.000002 20.6278 107
397 593 196 - MYCGA3960 Mycoplasma gallisepticum 471 650 0.000002 24.2424 107
405 618 213 - MYCGA2190 Mycoplasma gallisepticum 21 237 0.000002 22.6496 107
397 459 62 - MYCGA2460 Mycoplasma gallisepticum 6 67 0.000003 33.3333 106
46 634 588 - MG015 Mycoplasma genitalium 1 589 <1e-50 74.8727 2425
107 631 524 - MG014 Mycoplasma genitalium 75 611 2e-30 24.8239 313
390 613 223 - MG179 Mycoplasma genitalium 2 222 5e-20 31.0044 222
404 618 214 - MG410 Mycoplasma genitalium 90 312 3e-16 31.3305 190
368 609 241 - MG065 Mycoplasma genitalium 199 448 8e-16 25.8555 186
412 620 208 - MG467 Mycoplasma genitalium 104 308 0.000000000001 27.2321 158
403 621 218 - MG180 Mycoplasma genitalium 25 251 0.000000000002 27.2727 158
428 610 182 - MG119 Mycoplasma genitalium 38 224 0.000000000005 30.3665 154
416 621 205 - MG119 Mycoplasma genitalium 340 556 0.000000001 26.4574 154
371 610 239 - MG468.1 Mycoplasma genitalium 28 267 0.0000000006 24 136
412 621 209 - MG304 Mycoplasma genitalium 1 205 0.000000004 26.3636 128
413 494 81 - MG042 Mycoplasma genitalium 23 103 0.00000005 33.7349 119
502 614 112 - MG042 Mycoplasma genitalium 330 431 0.000002 27.5862 119
397 620 223 - MG290 Mycoplasma genitalium 7 241 0.0000002 24.1525 114
527 627 100 - MG187 Mycoplasma genitalium 361 466 0.000001 27.3585 107
390 511 121 - MG187 Mycoplasma genitalium 1 122 0.000006 24.4094 107
413 481 68 - MG080 Mycoplasma genitalium 30 103 0.000002 35.1351 106
534 619 85 - MG080 Mycoplasma genitalium 685 773 0.000005 30.1075 106
420 611 191 - MG303 Mycoplasma genitalium 97 292 0.000002 26.9231 106
412 620 208 - MHP7448_0340 Mycoplasma hyopneumoniae 7448 16 215 8e-19 31.9249 214
397 629 232 - MHP7448_0263 Mycoplasma hyopneumoniae 7448 2 235 5e-16 25.1046 189
412 611 199 - MHP7448_0305 Mycoplasma hyopneumoniae 7448 16 207 5e-16 27.7228 189
137 593 456 - MHP7448_0624 Mycoplasma hyopneumoniae 7448 64 505 0.000000000000001 24.2678 187
408 596 188 - MHP7448_0019 Mycoplasma hyopneumoniae 7448 12 190 0.000000000000003 30.9278 183
397 565 168 - MHP7448_0665 Mycoplasma hyopneumoniae 7448 325 486 0.000000000000005 28.9941 181
407 596 189 - MHP7448_0020 Mycoplasma hyopneumoniae 7448 11 190 0.000000000000007 32.3077 180
410 596 186 - MHP7448_0021 Mycoplasma hyopneumoniae 7448 14 190 0.00000000000007 29.8429 171
410 611 201 - MHP7448_0315 Mycoplasma hyopneumoniae 7448 14 207 0.0000000000005 27.4038 164
409 617 208 - MHP7448_0306 Mycoplasma hyopneumoniae 7448 13 212 0.000000000001 28.436 160
371 592 221 - MHP7448_0623 Mycoplasma hyopneumoniae 7448 312 522 0.000000000002 24.569 159
408 609 201 - MHP7448_0024 Mycoplasma hyopneumoniae 7448 12 204 0.000000000002 28.2927 159
412 618 206 - MHP7448_0452 Mycoplasma hyopneumoniae 7448 79 284 0.000000000005 25.5708 155
412 618 206 - MHP7448_0502 Mycoplasma hyopneumoniae 7448 29 249 0.000000000006 26.0684 154
413 622 209 - MHP7448_0514 Mycoplasma hyopneumoniae 7448 22 236 0.00000000001 28.6344 152
374 593 219 - MHP7448_0664 Mycoplasma hyopneumoniae 7448 306 513 0.00000000006 25.5605 146
380 592 212 - MHP7448_0627 Mycoplasma hyopneumoniae 7448 315 522 0.00000000006 24.6637 145
410 596 186 - MHP7448_0383 Mycoplasma hyopneumoniae 7448 14 191 0.0000000002 23.8579 142
408 593 185 - MHP7448_0628 Mycoplasma hyopneumoniae 7448 347 525 0.0000000003 25.3968 140
410 617 207 - MHP7448_0023 Mycoplasma hyopneumoniae 7448 14 211 0.0000000004 28.436 138
408 594 186 - MHP7448_0314 Mycoplasma hyopneumoniae 7448 12 189 0.0000000005 28.125 138
406 613 207 - MHP7448_0469 Mycoplasma hyopneumoniae 7448 15 217 0.000000001 25 135
416 611 195 - MHP7448_0231 Mycoplasma hyopneumoniae 7448 1 204 0.00000002 25 124
408 494 86 - MHP7448_0542 Mycoplasma hyopneumoniae 7448 21 106 0.00000002 32.9545 124
413 481 68 - MHP7448_0501 Mycoplasma hyopneumoniae 7448 24 97 0.0000001 29.7297 118
480 613 133 - MHP7448_0501 Mycoplasma hyopneumoniae 7448 579 699 0.0000006 28.9855 118
408 574 166 - MHP7448_0210 Mycoplasma hyopneumoniae 7448 12 196 0.0000001 21.1055 117
419 624 205 - MHP7448_0264 Mycoplasma hyopneumoniae 7448 29 251 0.000002 24.2291 106
416 619 203 - MHP7448_0214 Mycoplasma hyopneumoniae 7448 149 366 0.000004 24.6753 104
118 632 514 - MHO_3820 Mycoplasma hominis 103 619 <1e-50 36.8015 882
18 631 613 - MHO_2310 Mycoplasma hominis 3 603 <1e-50 31.3505 777
262 633 371 - MHO_3830 Mycoplasma hominis 230 602 <1e-50 31.6754 450
236 625 389 - MHO_2320 Mycoplasma hominis 198 584 8.99634e-43 30 419
397 613 216 - MHO_1970 Mycoplasma hominis 2 218 6e-17 31.0044 197
379 617 238 - MHO_3520 Mycoplasma hominis 71 313 0.00000000000002 25 174
397 618 221 - MHO_3570 Mycoplasma hominis 4 236 0.00000000000004 25.3165 172
381 597 216 - MHO_4410 Mycoplasma hominis 461 663 0.00000000004 25.4545 147
426 610 184 - MHO_4360 Mycoplasma hominis 42 222 0.0000000007 26.943 136
371 618 247 - MHO_1540 Mycoplasma hominis 29 286 0.00000004 23.6162 121
413 480 67 - MHO_1550 Mycoplasma hominis 32 104 0.000001 27.3973 108
418 491 73 - MHO_0740 Mycoplasma hominis 51 123 0.000002 28 105
408 494 86 - MHO_4450 Mycoplasma hominis 26 111 0.000004 27.2727 103
118 632 514 - MMOB5100 Mycoplasma mobile 99 624 <1e-50 36.3465 856
119 625 506 - MMOB5110 Mycoplasma mobile 77 577 <1e-50 26.7961 456
111 628 517 - MMOB3520 Mycoplasma mobile 59 569 6.99949e-42 24.3346 412
397 620 223 - MMOB4330 Mycoplasma mobile 11 234 7e-16 24.2424 188
413 613 200 - MMOB3870 Mycoplasma mobile 20 217 0.000000000000004 25.5924 182
374 582 208 - MMOB3500 Mycoplasma mobile 449 652 0.00000000003 26.009 148
413 622 209 - MMOB4320 Mycoplasma mobile 23 260 0.00000000004 27.3469 147
413 616 203 - MMOB0140 Mycoplasma mobile 23 232 0.00000000004 31.3901 146
389 593 204 - MMOB0100 Mycoplasma mobile 23 237 0.0000000001 27.7273 143
416 611 195 - MMOB0370 Mycoplasma mobile 23 220 0.000000004 28.8462 130
383 621 238 - MMOB4490 Mycoplasma mobile 409 656 0.00000005 24.6324 120
408 500 92 - MMOB0480 Mycoplasma mobile 43 138 0.00000005 32.6531 120
370 595 225 - MMOB1960 Mycoplasma mobile 28 236 0.00000006 24.8927 119
534 620 86 - MMOB4480 Mycoplasma mobile 602 691 0.0000001 36.1702 116
389 632 243 - MSC_0434 Mycoplasma mycoides subsp. mycoides SC 370 617 <1e-50 40.1606 452
421 633 212 - MSC_0435 Mycoplasma mycoides subsp. mycoides SC 403 618 8.00001e-41 39.3519 404
412 621 209 - MSC_0224 Mycoplasma mycoides subsp. mycoides SC 20 226 8e-19 28.2407 214
411 607 196 - MSC_0030 Mycoplasma mycoides subsp. mycoides SC 129 324 0.0000000000005 24.6377 164
383 624 241 - MSC_0718 Mycoplasma mycoides subsp. mycoides SC 128 367 0.00000000002 24.498 151
416 608 192 - MSC_0010 Mycoplasma mycoides subsp. mycoides SC 31 226 0.0000000001 30.8458 144
396 613 217 - MSC_0717 Mycoplasma mycoides subsp. mycoides SC 20 247 0.0000000001 25.3219 143
412 610 198 - MSC_0789 Mycoplasma mycoides subsp. mycoides SC 21 228 0.0000000008 24.6575 137
416 622 206 - MSC_0704 Mycoplasma mycoides subsp. mycoides SC 24 222 0.000000002 25.3589 134
416 592 176 - MSC_0487 Mycoplasma mycoides subsp. mycoides SC 4 187 0.000000003 23.8806 132
410 610 200 - MSC_0078 Mycoplasma mycoides subsp. mycoides SC 15 231 0.0000002 24.7748 117
412 619 207 - MSC_0967 Mycoplasma mycoides subsp. mycoides SC 110 333 0.0000002 22.1277 117
423 613 190 - MSC_0323 Mycoplasma mycoides subsp. mycoides SC 31 217 0.000001 24.3781 110
534 618 84 - MSC_0183 Mycoplasma mycoides subsp. mycoides SC 458 545 0.000003 35.2273 106
407 609 202 - MSC_0113 Mycoplasma mycoides subsp. mycoides SC 13 234 0.000004 26.5217 104
133 631 498 - MYPE4100 Mycoplasma penetrans 133 653 <1e-50 35.7553 875
111 631 520 - MYPE7530 Mycoplasma penetrans 69 589 <1e-50 33.2696 748
28 632 604 - MYPE2480 Mycoplasma penetrans 5 641 <1e-50 31.3936 742
147 628 481 - MYPE2470 Mycoplasma penetrans 102 584 <1e-50 28.5425 498
123 631 508 - MYPE4090 Mycoplasma penetrans 73 591 <1e-50 25.9328 490
113 631 518 - MYPE7540 Mycoplasma penetrans 65 583 1.4013e-45 25.7944 444
382 609 227 - MYPE3490 Mycoplasma penetrans 73 310 7e-19 28.5714 216
412 612 200 - MYPE10280 Mycoplasma penetrans 77 277 0.00000000000001 29.2453 179
406 609 203 - MYPE5570 Mycoplasma penetrans 161 402 0.00000000000003 26.749 176
409 593 184 - MYPE2200 Mycoplasma penetrans 355 532 0.0000000000002 25.9459 168
400 626 226 - MYPE9770 Mycoplasma penetrans 22 247 0.0000000000006 24.8945 164
415 611 196 - MYPE5890 Mycoplasma penetrans 120 318 0.000000000002 31.8627 160
409 609 200 - MYPE2210 Mycoplasma penetrans 359 553 0.000000000004 25 158
410 613 203 - MYPE9350 Mycoplasma penetrans 54 265 0.000000000008 26.9406 155
405 611 206 - MYPE3630 Mycoplasma penetrans 105 311 0.00000000001 27.027 152
409 634 225 - MYPE7450 Mycoplasma penetrans 15 240 0.0000000003 27.8481 142
406 610 204 - MYPE960 Mycoplasma penetrans 67 266 0.000000003 25.1142 133
379 623 244 - MYPE3080 Mycoplasma penetrans 61 298 0.000000007 24.2188 129
413 480 67 - MYPE8750 Mycoplasma penetrans 54 126 0.00000001 34.2466 128
534 619 85 - MYPE8750 Mycoplasma penetrans 628 716 0.0000008 33.3333 128
405 494 89 - MYPE8570 Mycoplasma penetrans 36 120 0.00000003 34.0659 124
403 610 207 - MYPE6610 Mycoplasma penetrans 9 226 0.00000004 23.6364 123
410 616 206 - MYPE3030 Mycoplasma penetrans 387 588 0.00000004 26.8519 123
412 568 156 - MYPE1880 Mycoplasma penetrans 23 169 0.0000004 24.8408 114
534 620 86 - MYPE5520 Mycoplasma penetrans 699 788 0.0000005 35.1064 113
411 618 207 - MYPE5530 Mycoplasma penetrans 45 302 0.000003 23.3083 107
409 617 208 - MYPE3560 Mycoplasma penetrans 89 292 0.000006 21.9626 104
408 621 213 - MYPE3570 Mycoplasma penetrans 14 245 0.000007 24.359 103
408 622 214 - Caulobacter crescentus NA1000 31 249 0.000005 26.5487 109
397 595 198 - Caulobacter crescentus NA1000 310 488 0.0000002 25.1256 120
412 610 198 - Caulobacter crescentus NA1000 29 227 0.0000002 25.6039 121
409 616 207 - Caulobacter crescentus NA1000 13 231 0.0000001 26.1603 122
413 614 201 - Caulobacter crescentus NA1000 19 223 0.00000004 26.0664 127
410 610 200 - Caulobacter crescentus NA1000 17 213 0.00000003 21.0784 128
416 618 202 - Caulobacter crescentus NA1000 23 219 0.00000002 22.6415 129
417 618 201 - Caulobacter crescentus NA1000 44 239 0.00000001 26.8519 132
394 576 182 - Caulobacter crescentus NA1000 17 182 0.000000003 24.8677 136
382 616 234 - Caulobacter crescentus NA1000 306 528 0.000000003 28.9796 137
417 624 207 - Caulobacter crescentus NA1000 25 224 0.0000000005 24.7748 143
397 614 217 - Caulobacter crescentus NA1000 15 233 0.0000000001 26.087 148
391 629 238 - Caulobacter crescentus NA1000 6 250 0.00000000002 23.6434 156
407 610 203 - Caulobacter crescentus NA1000 37 235 0.000000000007 25.7009 159
391 618 227 - Caulobacter crescentus NA1000 42 273 0.0000000000004 28.1633 169
408 627 219 - Caulobacter crescentus NA1000 14 240 0.0000000000001 27.9661 174
399 609 210 - Caulobacter crescentus NA1000 11 223 0.00000000000008 24.2009 176
411 618 207 - Caulobacter crescentus NA1000 16 224 0.00000000000001 25.1142 182
412 611 199 - Caulobacter crescentus NA1000 32 234 0.000000000000007 27.5701 185
397 608 211 - Caulobacter crescentus NA1000 2 216 1e-17 28.8889 209
396 590 194 - Caulobacter crescentus NA1000 342 532 5e-25 31.9797 272
390 619 229 - Caulobacter crescentus NA1000 323 553 6e-31 31.8966 324
392 607 215 - Caulobacter crescentus NA1000 493 707 4e-37 35.023 377
395 630 235 - Caulobacter crescentus NA1000 399 634 5.04467e-44 36.8644 437
328 631 303 - Caulobacter crescentus NA1000 287 591 <1e-50 39.2157 610
138 630 492 - Caulobacter crescentus NA1000 120 609 <1e-50 32.2772 673
417 621 204 - Lactococcus lactis subsp. lactis KF147 22 207 0.000002 20.6731 110
408 616 208 - Lactococcus lactis subsp. lactis KF147 12 238 0.0000006 22.7074 115
409 620 211 - Lactococcus lactis subsp. lactis KF147 15 235 0.0000001 26.2009 121
397 565 168 - Lactococcus lactis subsp. lactis KF147 4 169 0.00000006 26.3736 123
410 622 212 - Lactococcus lactis subsp. lactis KF147 15 230 0.00000003 26.9231 126
397 565 168 - Lactococcus lactis subsp. lactis KF147 3 170 0.00000002 26.8156 127
412 606 194 - Lactococcus lactis subsp. lactis KF147 16 211 0.00000002 26.4151 128
397 606 209 - Lactococcus lactis subsp. lactis KF147 328 512 0.000000007 27.9621 131
114 628 514 - LIC_10580 Leptospira interrogans serovar Copenhage 110 619 <1e-50 30.4183 619
147 628 481 - LIC_10532 Leptospira interrogans serovar Copenhage 141 617 <1e-50 31.1983 616
147 609 462 - LIC_10136 Leptospira interrogans serovar Copenhage 136 591 <1e-50 27.8618 473
116 618 502 - LIC_12182 Leptospira interrogans serovar Copenhage 107 584 <1e-50 29.4118 467
399 619 220 - LIC_13385 Leptospira interrogans serovar Copenhage 12 239 9e-17 27.459 201
410 589 179 - LIC_11544 Leptospira interrogans serovar Copenhage 17 193 0.00000000000004 27.8947 178
376 619 243 - LIC_13431 Leptospira interrogans serovar Copenhage 3 229 0.00000000000006 24.498 177
397 621 224 - LIC_11804 Leptospira interrogans serovar Copenhage 5 226 0.0000000000002 27.6596 171
412 590 178 - LIC_11081 Leptospira interrogans serovar Copenhage 30 210 0.000000000002 30.0518 164
412 611 199 - LIC_10518 Leptospira interrogans serovar Copenhage 23 225 0.000000000002 24.186 163
407 590 183 - LIC_11434 Leptospira interrogans serovar Copenhage 325 493 0.000000000004 27.2727 161
397 608 211 - LIC_12311 Leptospira interrogans serovar Copenhage 3 215 0.00000000001 24 156
397 617 220 - LIC_12079 Leptospira interrogans serovar Copenhage 7 232 0.00000000003 24.2553 153
413 618 205 - LIC_12526 Leptospira interrogans serovar Copenhage 15 224 0.00000000008 25 150
408 610 202 - LIC_11495 Leptospira interrogans serovar Copenhage 14 212 0.00000000009 27.619 149
380 633 253 - LIC_10538 Leptospira interrogans serovar Copenhage 284 540 0.0000000004 25.8741 144
401 620 219 - LIC_12428 Leptospira interrogans serovar Copenhage 18 235 0.0000000004 23.0435 144
397 609 212 - LIC_10389 Leptospira interrogans serovar Copenhage 328 522 0.0000000006 27.9279 142
412 612 200 - LIC_11824 Leptospira interrogans serovar Copenhage 20 231 0.0000000006 25.7778 142
387 616 229 - LIC_10631 Leptospira interrogans serovar Copenhage 4 236 0.000000001 26.4228 140
410 622 212 - LIC_11858 Leptospira interrogans serovar Copenhage 18 233 0.000000002 24 138
412 565 153 - LIC_10233 Leptospira interrogans serovar Copenhage 22 175 0.000000004 27.381 135
409 618 209 - LIC_10351 Leptospira interrogans serovar Copenhage 17 221 0.000000009 25.5507 132
411 619 208 - LIC_13384 Leptospira interrogans serovar Copenhage 24 246 0.00000006 24.3478 125
416 621 205 - LIC_13316 Leptospira interrogans serovar Copenhage 20 221 0.0000007 22.9358 116
412 618 206 - LIC_10671 Leptospira interrogans serovar Copenhage 22 231 0.000003 22.9075 111
134 631 497 - MS53_0506 Mycoplasma synoviae 107 617 <1e-50 33.5922 743
147 628 481 - MS53_0514 Mycoplasma synoviae 123 641 <1e-50 27.8311 530
147 631 484 - MS53_0513 Mycoplasma synoviae 101 582 <1e-50 28.6004 478
367 628 261 - MS53_0507 Mycoplasma synoviae 325 588 8.99999e-40 34.2105 394
397 621 224 - MS53_0659 Mycoplasma synoviae 2 227 1e-20 27.4262 228
389 606 217 - MS53_0086 Mycoplasma synoviae 2 214 0.00000000000001 26.8398 178
410 610 200 - MS53_0034 Mycoplasma synoviae 23 216 0.000000000002 28.1106 158
413 613 200 - MS53_0657 Mycoplasma synoviae 23 222 0.0000000001 27.907 142
413 613 200 - MS53_0660 Mycoplasma synoviae 23 247 0.0000000002 26.8085 141
414 609 195 - MS53_0137 Mycoplasma synoviae 23 222 0.000000006 31.0185 128
412 621 209 - MS53_0187 Mycoplasma synoviae 105 330 0.00000004 23.8095 121
412 618 206 - MS53_0346 Mycoplasma synoviae 27 249 0.00000004 24.7826 121
412 609 197 - MS53_0612 Mycoplasma synoviae 168 365 0.0000003 23.3333 113
378 523 145 - MS53_0145 Mycoplasma synoviae 94 250 0.0000009 30 109
409 483 74 - MS53_0508 Mycoplasma synoviae 26 98 0.000001 30.6667 109
534 592 58 - MS53_0041 Mycoplasma synoviae 4 62 0.000004 35.5932 104
413 480 67 - MS53_0345 Mycoplasma synoviae 32 104 0.000004 27.3973 104
141 631 490 - Rv1272c Mycobacterium tuberculosis 149 631 <1e-50 34.2159 805
117 628 511 - Rv0194 Mycobacterium tuberculosis 674 1174 <1e-50 24.6154 483
129 628 499 - Rv0194 Mycobacterium tuberculosis 86 565 8.96831e-44 24.9501 483
399 628 229 - Rv1348 Mycobacterium tuberculosis 612 840 <1e-50 40 480
396 630 234 - Rv1349 Mycobacterium tuberculosis 331 566 <1e-50 36.4407 477
240 631 391 - Rv1273c Mycobacterium tuberculosis 183 571 2e-40 28.0702 405
351 607 256 - MT1657 Mycobacterium tuberculosis 271 524 6e-24 27.5862 263
389 574 185 - MT1656 Mycobacterium tuberculosis 317 519 4e-22 27.5862 248
415 618 203 - MT3764 Mycobacterium tuberculosis 309 519 0.000000000000001 27.9476 192
416 613 197 - Rv1859 Mycobacterium tuberculosis 17 221 0.00000000000001 25.9259 184
407 589 182 - MT3186 Mycobacterium tuberculosis 13 194 0.00000000000005 27.4611 178
408 618 210 - Rv0933 Mycobacterium tuberculosis 32 249 0.00000000000005 28.1818 178
396 623 227 - MT2098 Mycobacterium tuberculosis 3 228 0.00000000000005 22.9167 178
410 616 206 - Rv0986 Mycobacterium tuberculosis 23 231 0.00000000000008 27.1889 176
413 614 201 - Rv2397c Mycobacterium tuberculosis 22 220 0.0000000000003 26.699 172
396 607 211 - MT2898 Mycobacterium tuberculosis 3 212 0.000000000002 23.2143 165
395 607 212 - Rv1747 Mycobacterium tuberculosis 317 528 0.000000000002 21.7195 164
395 565 170 - Rv2564 Mycobacterium tuberculosis 2 175 0.000000000005 28.3333 160
397 618 221 - Rv2688c Mycobacterium tuberculosis 18 233 0.0000000001 25 149
415 618 203 - Rv1281c Mycobacterium tuberculosis 379 587 0.0000000003 26.1062 146
413 618 205 - Rv1218c Mycobacterium tuberculosis 25 222 0.0000000003 24.8869 145
416 618 202 - MT1276 Mycobacterium tuberculosis 23 222 0.000000001 21.8605 140
370 576 206 - MT1519 Mycobacterium tuberculosis 305 495 0.000000003 26.4151 137
396 565 169 - Rv0073 Mycobacterium tuberculosis 8 175 0.000000005 28.5714 135
411 624 213 - MT1510 Mycobacterium tuberculosis 24 247 0.00000002 24.0175 130
425 592 167 - Rv0820 Mycobacterium tuberculosis 32 207 0.0000005 27.3224 117
385 596 211 - Rv1819c Mycobacterium tuberculosis 416 613 0.0000008 23.0415 116
416 596 180 - Rv0655 Mycobacterium tuberculosis 46 228 0.000001 24.0642 114
423 505 82 - MT3080 Mycobacterium tuberculosis 31 113 0.000002 26.506 112
401 576 175 - Rv2477c Mycobacterium tuberculosis 9 202 0.000006 25.8537 108
388 590 202 - Caulobacter crescentus NA1000 328 509 0.00000003 25.3589 128
408 619 211 - Caulobacter crescentus NA1000 21 231 0.000000001 25.1082 140
408 592 184 - Caulobacter crescentus NA1000 17 196 0.0000000002 27.6042 147
406 623 217 - Caulobacter crescentus NA1000 20 232 0.00000000003 26.4069 153
400 609 209 - Caulobacter crescentus NA1000 11 223 0.00000000001 24.424 157
408 627 219 - Caulobacter crescentus NA1000 18 241 0.0000000000005 26.8085 169
387 574 187 - Caulobacter crescentus NA1000 5 182 0.000000000000006 29.8429 186
413 591 178 - Caulobacter crescentus NA1000 336 501 9e-21 30.9392 236
395 628 233 - Caulobacter crescentus NA1000 355 589 <1e-50 43.4043 535
397 568 171 - Lactococcus lactis subsp. lactis KF147 3 165 0.0000004 27.4286 116
412 610 198 - Lactococcus lactis subsp. lactis KF147 15 200 0.00000002 23.5294 128
413 618 205 - Lactococcus lactis subsp. lactis KF147 20 217 0.000000007 25.6881 131
108 631 523 - Lactococcus lactis subsp. lactis KF147 90 621 <1e-50 35.6215 870
122 628 506 - Lactococcus lactis subsp. lactis KF147 162 656 <1e-50 31.8982 684
147 630 483 - Lactococcus lactis subsp. lactis KF147 106 600 <1e-50 28.2306 535
128 628 500 - Lactococcus lactis subsp. lactis KF147 72 570 <1e-50 28.655 534
113 628 515 - Lactococcus lactis subsp. lactis KF147 62 569 <1e-50 28.4644 507
147 627 480 - Lactococcus lactis subsp. lactis KF147 107 580 <1e-50 29.3173 477
134 620 486 - Lactococcus lactis subsp. lactis KF147 74 575 4e-39 23.2558 393
413 628 215 - Lactococcus lactis subsp. lactis KF147 348 562 1e-32 32.7189 336
396 631 235 - Lactococcus lactis subsp. lactis KF147 339 567 3e-28 33.6134 298
340 628 288 - Lactococcus lactis subsp. lactis KF147 280 565 2e-27 26.5517 291
420 592 172 - Lactococcus lactis subsp. lactis KF147 363 527 6e-20 30.6818 227
406 618 212 - Lactococcus lactis subsp. lactis KF147 14 227 5e-19 28.8991 219
412 618 206 - Lactococcus lactis subsp. lactis KF147 16 226 1e-18 29.4118 216
417 619 202 - Lactococcus lactis subsp. lactis KF147 48 253 8e-18 30.4147 208
406 582 176 - Lactococcus lactis subsp. lactis KF147 13 183 3e-17 30.8989 204
413 611 198 - Lactococcus lactis subsp. lactis KF147 23 220 5e-17 27.2727 201
416 617 201 - Lactococcus lactis subsp. lactis KF147 26 224 1e-16 31.7536 198
397 610 213 - Lactococcus lactis subsp. lactis KF147 5 219 2e-16 28.821 197
412 618 206 - Lactococcus lactis subsp. lactis KF147 21 228 3e-16 28.6364 196
386 607 221 - Lactococcus lactis subsp. lactis KF147 3 218 3e-16 27.6151 195
397 607 210 - Lactococcus lactis subsp. lactis KF147 2 212 0.000000000000002 30.137 188
410 621 211 - Lactococcus lactis subsp. lactis KF147 16 233 0.00000000000002 28.9474 178
406 611 205 - Lactococcus lactis subsp. lactis KF147 15 228 0.0000000000004 26.8722 168
408 624 216 - Lactococcus lactis subsp. lactis KF147 309 524 0.00000000001 27.0386 162
397 634 237 - Lactococcus lactis subsp. lactis KF147 5 253 0.000000000002 27.6265 162
411 609 198 - Lactococcus lactis subsp. lactis KF147 21 220 0.000000000003 24.1706 161
412 611 199 - Lactococcus lactis subsp. lactis KF147 17 219 0.000000000005 26.57 159
409 622 213 - Lactococcus lactis subsp. lactis KF147 16 226 0.000000000005 26.009 158
397 624 227 - Lactococcus lactis subsp. lactis KF147 2 237 0.000000000007 26.2295 157
397 613 216 - Lactococcus lactis subsp. lactis KF147 6 220 0.000000000009 25.5605 156
406 593 187 - Lactococcus lactis subsp. lactis KF147 31 225 0.00000000001 28.2178 156
413 607 194 - Lactococcus lactis subsp. lactis KF147 24 219 0.00000000001 25.3659 155
411 621 210 - Lactococcus lactis subsp. lactis KF147 15 222 0.00000000001 27.1493 155
397 621 224 - Lactococcus lactis subsp. lactis KF147 2 236 0.00000000002 24.4726 153
406 618 212 - Lactococcus lactis subsp. lactis KF147 19 245 0.00000000002 25.3219 153
413 609 196 - Lactococcus lactis subsp. lactis KF147 275 481 0.000008 24.0566 153
416 614 198 - Lactococcus lactis subsp. lactis KF147 25 228 0.00000000002 29.717 153
406 614 208 - Lactococcus lactis subsp. lactis KF147 11 215 0.00000000003 29.2237 152
408 618 210 - Lactococcus lactis subsp. lactis KF147 15 219 0.00000000003 26.7281 152
407 621 214 - Lactococcus lactis subsp. lactis KF147 26 239 0.00000000004 24.8908 151
397 601 204 - Lactococcus lactis subsp. lactis KF147 4 218 0.00000000004 30.0448 151
410 606 196 - Lactococcus lactis subsp. lactis KF147 18 200 0.00000000007 28.9855 148
416 620 204 - Lactococcus lactis subsp. lactis KF147 29 246 0.00000000008 23.7069 148
413 613 200 - Lactococcus lactis subsp. lactis KF147 31 237 0.0000000001 26.009 147
416 618 202 - Lactococcus lactis subsp. lactis KF147 32 243 0.0000000002 26.6376 144
410 565 155 - Lactococcus lactis subsp. lactis KF147 14 166 0.0000000007 24.0506 140
409 609 200 - Lactococcus lactis subsp. lactis KF147 14 201 0.0000000007 26.601 140
420 611 191 - Lactococcus lactis subsp. lactis KF147 31 240 0.000000003 23.7668 135
417 590 173 - Lactococcus lactis subsp. lactis KF147 23 194 0.000000003 24.3243 135
412 593 181 - Lactococcus lactis subsp. lactis KF147 27 205 0.000000003 26.5306 134
132 631 499 - Bacillus subtilis subsp. subtilis 107 600 <1e-50 36.9781 817
132 631 499 - Bacillus subtilis subsp. subtilis 107 600 <1e-50 36.1829 797
31 631 600 - Bacillus subtilis subsp. subtilis 22 597 <1e-50 29.3548 693
31 631 600 - Bacillus subtilis subsp. subtilis 22 597 <1e-50 29.1667 692
132 628 496 - Bacillus subtilis subsp. subtilis 76 567 <1e-50 29.7619 670
132 628 496 - Bacillus subtilis subsp. subtilis 85 576 <1e-50 29.7619 666
147 628 481 - Bacillus subtilis subsp. subtilis 97 573 <1e-50 30.7216 659
147 628 481 - Bacillus subtilis subsp. subtilis 76 552 <1e-50 30.7216 658
123 628 505 - Bacillus subtilis subsp. subtilis 159 661 <1e-50 31.5789 631
113 628 515 - Bacillus subtilis subsp. subtilis 149 661 <1e-50 30.7839 625
131 634 503 - Bacillus subtilis subsp. subtilis 87 579 <1e-50 30.572 591
134 631 497 - Bacillus subtilis subsp. subtilis 48 539 <1e-50 28.9683 590
131 634 503 - Bacillus subtilis subsp. subtilis 87 579 <1e-50 30.3748 587
134 631 497 - Bacillus subtilis subsp. subtilis 76 567 <1e-50 28.373 583
123 631 508 - Bacillus subtilis subsp. subtilis 64 563 <1e-50 28.9773 523
113 625 512 - Bacillus subtilis subsp. subtilis 63 566 <1e-50 30.1527 521
123 631 508 - Bacillus subtilis subsp. subtilis 64 563 <1e-50 28.5985 519
113 625 512 - Bacillus subtilis subsp. subtilis 63 566 <1e-50 29.9618 513
340 628 288 - Bacillus subtilis subsp. subtilis 275 567 4e-36 29.9663 370
340 628 288 - Bacillus subtilis subsp. subtilis 275 567 9e-36 29.6296 367
413 631 218 - Bacillus subtilis subsp. subtilis 343 561 1e-32 33.3333 340
432 631 199 - Bacillus subtilis subsp. subtilis 362 561 2e-32 33.5 338
21 590 569 - Bacillus subtilis subsp. subtilis 142 675 1e-29 23.0769 315
397 628 231 - Bacillus subtilis subsp. subtilis 7 239 1e-19 30.4878 228
417 619 202 - Bacillus subtilis subsp. subtilis 25 230 1e-18 31.3364 220
417 619 202 - Bacillus subtilis subsp. subtilis 53 258 2e-18 31.3364 219
384 616 232 - Bacillus subtilis subsp. subtilis 6 247 2e-18 30.1158 218
384 616 232 - Bacillus subtilis subsp. subtilis 6 247 3e-18 30.1158 217
395 620 225 - Bacillus subtilis subsp. subtilis 3 228 3e-18 24.4726 216
397 620 223 - Bacillus subtilis subsp. subtilis 2 225 5e-18 24.2553 214
397 618 221 - Bacillus subtilis subsp. subtilis 2 223 7e-17 27.8261 205
397 618 221 - Bacillus subtilis subsp. subtilis 2 223 7e-17 27.8261 205
401 613 212 - Bacillus subtilis subsp. subtilis 16 230 7e-17 30.8036 204
416 611 195 - Bacillus subtilis subsp. subtilis 22 212 8e-17 29.5238 204
401 613 212 - Bacillus subtilis subsp. subtilis 9 223 9e-17 30.8036 204
412 622 210 - Bacillus subtilis subsp. subtilis 309 514 2e-16 25.5814 201
400 593 193 - Bacillus subtilis subsp. subtilis 11 210 0.0000002 26.6355 201
405 623 218 - Bacillus subtilis subsp. subtilis 17 221 2e-16 26.7857 201
399 620 221 - Bacillus subtilis subsp. subtilis 4 225 2e-16 24.4635 201
399 620 221 - Bacillus subtilis subsp. subtilis 4 225 2e-16 24.4635 200
413 608 195 - Bacillus subtilis subsp. subtilis 25 222 2e-16 25.9434 200
389 622 233 - Bacillus subtilis subsp. subtilis 275 514 3e-16 24.498 200
400 593 193 - Bacillus subtilis subsp. subtilis 11 210 0.00000002 27.619 200
413 608 195 - Bacillus subtilis subsp. subtilis 25 222 3e-16 25.9434 199
422 628 206 - Bacillus subtilis subsp. subtilis 3 208 4e-16 30.137 198
405 623 218 - Bacillus subtilis subsp. subtilis 17 221 7e-16 26.3393 196
397 616 219 - Bacillus subtilis subsp. subtilis 13 230 0.000000000000001 27.4336 195
412 618 206 - Bacillus subtilis subsp. subtilis 16 226 0.000000000000002 29.4118 193
413 610 197 - Bacillus subtilis subsp. subtilis 39 238 0.000000000000002 27.8049 193
413 609 196 - Bacillus subtilis subsp. subtilis 23 221 0.000000000000002 27.9412 192
397 607 210 - Bacillus subtilis subsp. subtilis 2 213 0.000000000000002 27.1889 192
397 607 210 - Bacillus subtilis subsp. subtilis 2 213 0.000000000000002 27.1889 192
397 614 217 - Bacillus subtilis subsp. subtilis 13 228 0.000000000000003 26.7857 191
415 621 206 - Bacillus subtilis subsp. subtilis 29 242 0.000000000000004 27.3543 189
415 621 206 - Bacillus subtilis subsp. subtilis 29 242 0.000000000000005 27.3543 188
400 619 219 - Bacillus subtilis subsp. subtilis 7 228 0.000000000000005 27.7778 188
396 613 217 - Bacillus subtilis subsp. subtilis 3 217 0.000000000000006 24.5614 188
396 613 217 - Bacillus subtilis subsp. subtilis 3 217 0.000000000000006 23.6842 188
412 621 209 - Bacillus subtilis subsp. subtilis 16 229 0.000000000000007 27.5229 187
400 619 219 - Bacillus subtilis subsp. subtilis 7 228 0.000000000000009 26.9565 186
395 624 229 - Bacillus subtilis subsp. subtilis 2 233 0.00000000000001 25.4237 186
411 610 199 - Bacillus subtilis subsp. subtilis 19 219 0.00000000000001 27.1845 186
411 610 199 - Bacillus subtilis subsp. subtilis 19 219 0.00000000000001 27.1845 186
389 610 221 - Bacillus subtilis subsp. subtilis 3 219 0.00000000000002 24.7934 183
395 624 229 - Bacillus subtilis subsp. subtilis 2 233 0.00000000000003 25 181
412 610 198 - Bacillus subtilis subsp. subtilis 20 219 0.00000000000005 25.5708 180
370 619 249 - Bacillus subtilis subsp. subtilis 4 250 0.00000000000008 25.7576 178
397 591 194 - Bacillus subtilis subsp. subtilis 4 197 0.0000000000001 27.4882 176
416 618 202 - Bacillus subtilis subsp. subtilis 24 224 0.0000000000003 26.57 174
397 591 194 - Bacillus subtilis subsp. subtilis 4 197 0.0000000000005 27.0142 172
397 619 222 - Bacillus subtilis subsp. subtilis 4 228 0.0000000000005 24.8945 171
412 614 202 - Bacillus subtilis subsp. subtilis 17 222 0.0000000000007 27.7512 170
412 614 202 - Bacillus subtilis subsp. subtilis 17 222 0.0000000000008 27.7512 170
420 618 198 - Bacillus subtilis subsp. subtilis 28 224 0.0000000000009 27.0936 169
416 590 174 - Bacillus subtilis subsp. subtilis 26 193 0.000000000002 27.3743 166
416 590 174 - Bacillus subtilis subsp. subtilis 26 193 0.000000000002 27.3743 166
412 628 216 - Bacillus subtilis subsp. subtilis 19 230 0.000000000003 30.0885 165
420 618 198 - Bacillus subtilis subsp. subtilis 1 203 0.000000000003 28.169 165
386 614 228 - Bacillus subtilis subsp. subtilis 3 216 0.000000000004 24.8945 164
386 614 228 - Bacillus subtilis subsp. subtilis 4 217 0.000000000005 24.8945 163
412 618 206 - Bacillus subtilis subsp. subtilis 16 227 0.000000000005 27.6786 163
412 618 206 - Bacillus subtilis subsp. subtilis 16 227 0.000000000006 27.6786 162
410 618 208 - Bacillus subtilis subsp. subtilis 18 217 0.000000000006 26.9767 162
416 608 192 - Bacillus subtilis subsp. subtilis 23 217 0.000000000008 30.4569 161
410 620 210 - Bacillus subtilis subsp. subtilis 14 225 0.000000000009 25.463 161
410 620 210 - Bacillus subtilis subsp. subtilis 14 225 0.00000000001 25.463 159
410 589 179 - Bacillus subtilis subsp. subtilis 17 185 0.00000000002 28.2609 158
413 592 179 - Bacillus subtilis subsp. subtilis 11 197 0.00000000002 31.2821 158
413 592 179 - Bacillus subtilis subsp. subtilis 21 207 0.00000000002 31.2821 157
415 621 206 - Bacillus subtilis subsp. subtilis 26 246 0.00000000002 26.6094 157
406 618 212 - Bacillus subtilis subsp. subtilis 10 230 0.00000000003 27.0742 156
406 618 212 - Bacillus subtilis subsp. subtilis 52 272 0.00000000003 27.0742 156
410 609 199 - Bacillus subtilis subsp. subtilis 18 212 0.00000000004 26.5403 155
411 611 200 - Bacillus subtilis subsp. subtilis 22 236 0.00000000004 27.3913 155
411 611 200 - Bacillus subtilis subsp. subtilis 22 236 0.00000000004 27.3913 155
415 621 206 - Bacillus subtilis subsp. subtilis 26 246 0.00000000004 27.0386 155
410 609 199 - Bacillus subtilis subsp. subtilis 33 227 0.00000000005 26.0664 154
416 608 192 - Bacillus subtilis subsp. subtilis 23 217 0.00000000005 29.9492 154
410 633 223 - Bacillus subtilis subsp. subtilis 20 245 0.00000000006 22.6891 153
410 633 223 - Bacillus subtilis subsp. subtilis 20 245 0.00000000008 22.6891 152
397 611 214 - Bacillus subtilis subsp. subtilis 2 216 0.00000000009 25.4545 152
397 597 200 - Bacillus subtilis subsp. subtilis 7 204 0.00000000009 25.3456 152
406 618 212 - Bacillus subtilis subsp. subtilis 17 243 0.00000000009 26.6667 152
406 618 212 - Bacillus subtilis subsp. subtilis 17 243 0.0000000001 26.6667 152
397 597 200 - Bacillus subtilis subsp. subtilis 4 201 0.0000000002 25.2427 149
397 611 214 - Bacillus subtilis subsp. subtilis 2 216 0.0000000002 25.4545 149
408 592 184 - Bacillus subtilis subsp. subtilis 12 192 0.0000000003 27.0833 148
397 607 210 - Bacillus subtilis subsp. subtilis 4 215 0.0000000008 25.2252 143
397 614 217 - Bacillus subtilis subsp. subtilis 4 207 0.000000001 25.1101 143
399 609 210 - Bacillus subtilis subsp. subtilis 6 212 0.000000001 22.5225 143
408 623 215 - Bacillus subtilis subsp. subtilis 12 224 0.000000001 25 143
399 609 210 - Bacillus subtilis subsp. subtilis 6 212 0.000000001 22.5225 142
408 623 215 - Bacillus subtilis subsp. subtilis 12 224 0.000000003 24.5614 139
397 616 219 - Bacillus subtilis subsp. subtilis 327 527 0.000000003 24.4635 138
397 616 219 - Bacillus subtilis subsp. subtilis 327 527 0.000000003 24.4635 138
397 582 185 - Bacillus subtilis subsp. subtilis 2 187 0.000000004 22.8856 138
406 621 215 - Bacillus subtilis subsp. subtilis 13 231 0.000000004 23.5043 138
406 621 215 - Bacillus subtilis subsp. subtilis 13 231 0.000000004 23.5043 138
416 618 202 - Bacillus subtilis subsp. subtilis 31 241 0.000000006 23.3945 136
416 618 202 - Bacillus subtilis subsp. subtilis 28 238 0.000000006 23.3945 136
412 609 197 - Bacillus subtilis subsp. subtilis 64 254 0.00000001 27.0531 133
413 618 205 - Bacillus subtilis subsp. subtilis 23 233 0.00000002 26.6055 132
413 618 205 - Bacillus subtilis subsp. subtilis 23 233 0.00000002 26.6055 132
412 609 197 - Bacillus subtilis subsp. subtilis 19 209 0.00000003 27.0531 130
408 620 212 - Bacillus subtilis subsp. subtilis 14 249 0.00000004 24.1803 129
408 620 212 - Bacillus subtilis subsp. subtilis 14 249 0.00000004 24.1803 129
410 624 214 - Bacillus subtilis subsp. subtilis 18 243 0.00000008 23.913 126
410 624 214 - Bacillus subtilis subsp. subtilis 18 243 0.00000008 23.913 126
412 621 209 - Bacillus subtilis subsp. subtilis 16 217 0.00000009 24.4131 126
412 621 209 - Bacillus subtilis subsp. subtilis 16 217 0.00000009 24.4131 126
397 582 185 - Bacillus subtilis subsp. subtilis 2 187 0.0000001 24.7475 125
396 565 169 - Bacillus subtilis subsp. subtilis 2 157 0.0000004 26.7442 120
405 623 218 - Bacillus subtilis subsp. subtilis 12 226 0.000001 23.2456 116
405 623 218 - Bacillus subtilis subsp. subtilis 12 226 0.000001 23.2456 116
416 565 149 - Bacillus subtilis subsp. subtilis 20 159 0.000002 27.3885 115
396 565 169 - Bacillus subtilis subsp. subtilis 2 157 0.000002 26.5896 114
410 572 162 - Bacillus subtilis subsp. subtilis 15 181 0.000004 27.8107 112
410 572 162 - Bacillus subtilis subsp. subtilis 15 181 0.000007 26.8571 110
389 593 204 - Mycoplasma pulmonis 69 259 3e-17 30.2885 200
397 613 216 - Mycoplasma pulmonis 2 218 8e-16 26.9911 188
426 593 167 - Mycoplasma pulmonis 365 522 0.000000000000002 31.7647 184
409 618 209 - Mycoplasma pulmonis 48 254 0.000000000000003 23.1818 183
378 565 187 - Mycoplasma pulmonis 305 488 0.00000000000005 29.8969 173
375 597 222 - Mycoplasma pulmonis 450 668 0.0000000000005 25.1101 164
409 596 187 - Mycoplasma pulmonis 13 196 0.000000000009 26.3959 153
409 611 202 - Mycoplasma pulmonis 15 213 0.00000000001 23.9437 153
412 565 153 - Mycoplasma pulmonis 86 237 0.0000000006 24.5399 137
408 495 87 - Mycoplasma pulmonis 30 120 0.000000002 33.3333 134
383 594 211 - Mycoplasma pulmonis 323 520 0.00000002 24.2991 125
422 619 197 - Mycoplasma pulmonis 167 380 0.00000002 25.4386 124
413 608 195 - Mycoplasma pulmonis 24 224 0.00000005 32.2275 121
413 621 208 - Mycoplasma pulmonis 22 225 0.00000007 25.6757 120
417 505 88 - Mycoplasma pulmonis 56 142 0.0000002 30 115
522 618 96 - Mycoplasma pulmonis 280 379 0.000005 25.7426 115
413 480 67 - Mycoplasma pulmonis 28 100 0.0000003 30.137 114
534 618 84 - Mycoplasma pulmonis 624 711 0.000005 32.9545 114
410 485 75 - Mycoplasma pulmonis 26 93 0.0000005 32.8947 113
416 610 194 - Mycoplasma pulmonis 23 219 0.0000005 28.1553 113
413 483 70 - Mycoplasma pulmonis 48 116 0.000002 29.5775 108
420 624 204 - Mycoplasma pulmonis 30 254 0.000008 23.4783 102
External IDs
Alias
YfiC
COG
COG1132V
Gene ID
877382
GI
13507758
GO
Lipid metabolism
Home COG
I
InterPro
IPR000294|Vitamin K-dependent carboxylation/gamma-carboxyglutamic region
InterPro
IPR003593|AAA ATPase
InterPro
IPR003439|ABC Transporter related
InterPro
IPR001140|ABC Transporter, transmembrane region
InterPro
IPR011527|ABC Transporter, transmembrane region, type 1
Old MP number
MP135
Pathway
Transporter, ABC superfamily
Pathway
drug efflux
Pfam
PF00350
Pfam
PF01926
Pfam
PF03193
Pfam
PF00664
Pfam
PF00005
PID
g1673794
RefSeq
NP_109707.1
Swiss-Prot protein ID
Y019_MYCPN
phylomeDB tree
Y019_MYCPN
UniProt
P75094
Transcription
IMAGE BROWSERS

OPERON OP8 (Genomic Overview)
Region:19314-29803

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn019STRING legend