Gene gyrA (MPN004)
Name
gyrA
Stable ID
MPN004
Location
4821 - 7340 +
Sequence
    1  ATGGCAAAGC AACAAGATCA AATTGACAAA ATTCGTCAGG AATTAGCACA ATCAGCAATT
   61  AAAAACATCT CCCTCTCCAG TGAACTAGAA CGTTCCTTCA TGGAGTATGC GATGTCGGTG
  121  ATAGTGGCTC GCGCGCTCCC AGATGCGAGG GATGGACTTA AACCTGTGCA CCGCCGTGTG
  181  CTCTATGGTG CTTACACTGG GGGCATGCAC CACGATCGCC CCTTTAAAAA GTCAGCACGG
  241  ATTGTCGGTG ATGTAATGAG TAAGTTCCAC CCCCACGGGG ACATGGCCAT TTACGACACA
  301  ATGTCGCGGA TGGCGCAGGA CTTTTCTTTG CGTTACCTCT TAATTGACGG ACATGGTAAC
  361  TTTGGCTCGA TTGATGGCGA TCGTCCCGCA GCACAACGTT ATACGGAAGC ACGGTTGTCG
  421  AAATTAGCGG GGGAACTGTT ACGTGACATT GACAAGGACA CGGTCGACTT TGTCGCTAAC
  481  TATGATGGGG AAGAACAAGA ACCAACGGTT TTACCAGCTG CCTTTCCTAA TTTATTAGCT
  541  AATGGTTCGA GTGGGATTGC GGTAGGGATG TCCACTTCCA TTCCGTCTCA CAACTTATCG
  601  GAGTTAATCC AGGGCTTAAT CCTTTTAATT GACAACCCTG ACTGCACCAT TAATGATTTA
  661  TTAGGTGTCA TTAAAGGACC GGACTTTCCC ACCGGAGCCA ACATTATTTA CACCAAGGGG
  721  ATTGAAAGCT ACTTTGAAAC TGGGAAGGGT AATGTGGTCA TTCGTTCTAA AGTCAGCATT
  781  GAACAACTAC CAACCCGGGC TGCTTTAGTA GTCACGGAAA TTCCCTACAT GGTCAACAAG
  841  ACCAGTTTAA TTGAAAAGAT TGTCGAGTTA GTCAAGGCTG AGGAAATCAC CGGGATTGCC
  901  GATATCCGTG ATGAGTCATC CAGGGAAGGA ATTCGCTTGG TGATTGAAGT GAAGCGCGAC
  961  ACCGTTCCGG AAGTCTTATT AAACCAACTG TTCAAATCAA CCCGTTTACA GGTGCGGTTC
 1021  CCCGTGAACA TGTTGGCACT GGTTAAGGGT GCACCTAAAT TGCTTAACAT GAAGCAAGCG
 1081  TTAACGGTTT ACCTCGAGCA CCAACTCGAT GTTCTGATTC GCAAAACCCA GTTTAACCTC
 1141  AAGAAGTACC AGGAGCGCTT TCATATCTTA AGTGGCCTTT TAATTGCGGC GTTGAACATT
 1201  GATGAGGTAA TTGCGATCAT TAAAAAGTCC GCTAATAACC AGGTAGCAAT GGAAGCACTC
 1261  CACGAACGCT TCGGGTTAGA TGAAATCCAA GCACGGGCGG TTCTGGACAT GCGTTTACGT
 1321  AGCTTAAGTG TCTTGGAAGT CAATAAACTA CAAACCGAAC AACAAGAGTT GAAAGCTTTA
 1381  ATTGAGTTCT GTCAACAGGT GTTAGCTGAC AAACAACTGC AACTCAAACT AATTAAGGAG
 1441  CAGTTAACCA AGATTAACGA ACAGTTTGGC GATCCACGCC GTAGTGAAAT CCTGTACGGT
 1501  ATTAGTGAAG ACATTGATGA TGAGGACTTA ATTACCCAGG AAAACGTGGT AATCACGATG
 1561  TCCACTAACG GTTATCTCAA ACGGATTGGG GTAGACGCTT ATAACCTGCA ACACCGTGGT
 1621  GGGGTGGGTG TTAAGGGTTT AACTACCTAC ACCGATGACA GTATTAGCCA GCTGTTAGTC
 1681  TGCTCGACCC ACTCGGACCT CTTATTCTTT ACGGACAAGG GAAAGGTCTA CCGCATCCGG
 1741  GCCCACCAAA TTCCCCCGGG TTTTCGTACT AACAAGGGGA TTCCGGCGGT TAACCTGATT
 1801  AAGATCGACA AGGACGAGAA GATCTGTGCC TTAATTTCGG TGAATGATTA CCAAAATGGT
 1861  TACTTCTTCT TTTGTACCAA GAACGGTACC ATTAAGCGCA CCAGTCTAAG TGAGTTTGCC
 1921  AACATCTTGA GTATTGGTAA ACGCGCCATC CTCTTTAAGG AAAACGATGT TTTGTTCTCG
 1981  GTTATTCGCA CCAGTGGTCA AGATGACATC TTTATCGGTT CGACCGCGGG GTTTGTCGTG
 2041  CGTTTCCACG AAGACACCGT CCGTCCGCTG TCCCGCGCTG CCATGGGGGT CTTGGGGATT
 2101  AATCTCAACC AGTGCGAATT TGTCAATGGT CTGTCCACTT CCAGTAACGG GAGTTTATTA
 2161  CTCTCTGTGG GTCAAAATGG CATTGGTAAG CTCACCAGTA TTGACAAATA TCGTTTAACC
 2221  AAGCGGAATG CTAAGGGAGT TAAAACACTA CGAGTAACTG CTAAAACTGG TCCGGTTGTG
 2281  ACCACTACGA CCGTCTTTGG TAACGAAGAT TTGTTAATGA TTTCTTCAGC TGGTAAGATT
 2341  GTCCGGATTA GTCTGGAACA ACTTTCAGAA CAGCGAAAAA ACACTTCTGG TGTTAAACTA
 2401  ATCAAACTAA AAGAGAAGGA ACGCTTAGAG ACTGTTACTA TCTTTAAAAA GGAAGAAGCC
 2461  ATTAAAACCA CAACAGCAAC CGAGACAGAC GATGTTGGAT CGAAACAAAT TACGCAATAA
Download Sequence
Operon
OP2
Operon location
2800 - 11960
Protein (mpn004)
Name
DNA gyrase subunit A (EC 5.99.1.3)
Stable ID
Mpn004
Molecular Weight
92290
Isoelectric Point
9
Localization
Cytoplasm
Comment DNA gyrase subunit A; DNA breaking and rejoining
Sequence
MAKQQDQIDKIRQELAQSAIKNISLSSELERSFMEYAMSVIVARALPDARDGLKPVHRRVLYGAYTGGMHHDRPFKKSAR
IVGDVMSKFHPHGDMAIYDTMSRMAQDFSLRYLLIDGHGNFGSIDGDRPAAQRYTEARLSKLAGELLRDIDKDTVDFVAN
YDGEEQEPTVLPAAFPNLLANGSSGIAVGMSTSIPSHNLSELIQGLILLIDNPDCTINDLLGVIKGPDFPTGANIIYTKG
IESYFETGKGNVVIRSKVSIEQLPTRAALVVTEIPYMVNKTSLIEKIVELVKAEEITGIADIRDESSREGIRLVIEVKRD
TVPEVLLNQLFKSTRLQVRFPVNMLALVKGAPKLLNMKQALTVYLEHQLDVLIRKTQFNLKKYQERFHILSGLLIAALNI
DEVIAIIKKSANNQVAMEALHERFGLDEIQARAVLDMRLRSLSVLEVNKLQTEQQELKALIEFCQQVLADKQLQLKLIKE
QLTKINEQFGDPRRSEILYGISEDIDDEDLITQENVVITMSTNGYLKRIGVDAYNLQHRGGVGVKGLTTYTDDSISQLLV
CSTHSDLLFFTDKGKVYRIRAHQIPPGFRTNKGIPAVNLIKIDKDEKICALISVNDYQNGYFFFCTKNGTIKRTSLSEFA
NILSIGKRAILFKENDVLFSVIRTSGQDDIFIGSTAGFVVRFHEDTVRPLSRAAMGVLGINLNQCEFVNGLSTSSNGSLL
LSVGQNGIGKLTSIDKYRLTKRNAKGVKTLRVTAKTGPVVTTTTVFGNEDLLMISSAGKIVRISLEQLSEQRKNTSGVKL
IKLKEKERLETVTIFKKEEAIKTTTATETDDVGSKQITQ
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation SFmEYAmSVIVAR 32 45 M
Oxidation SFmEYAMSVIVAR 32 45 M
Oxidation SFMEYAmSVIVAR 32 45 M
Oxidation VLYGAYTGGmHHDRPFK 60 77 M
Oxidation VLYGAYTGGmHHDRPFKK 60 78 M
Oxidation VLYGAYTGGmHHDRPFKKSAR 60 81 M
Oxidation IVGDVmSK 81 89 M
Oxidation IVGDVMSKFHPHGDmAIYDTMSR 81 104 M
Oxidation FHPHGDmAIYDTmSR 89 104 M
Oxidation FHPHGDmAIYDTMSR 89 104 M
Oxidation FHPHGDMAIYDTmSR 89 104 M
Oxidation mAQDFSLR 104 112 M
Oxidation AALVVTEIPYmVNK 267 281 M
Oxidation AALVVTEIPYmVNk 267 281 M
Oxidation AALVVTEIPYmVNKTSLIEK 267 287 M
Oxidation AALVVTEIPYmVNKTSLIEKIVELVK 267 293 M
Oxidation LQVRFPVNmLALVK 336 350 M
Oxidation FPVNmLALVK 340 350 M
Oxidation LLNmKQALTVYLEHQLDVLIR 354 375 M
Oxidation LLNmKQALTVYLEHQLDVLIRK 354 376 M
Oxidation KSANNQVAmEALHER 409 424 M
Oxidation SANNQVAmEALHER 410 424 M
Oxidation AVLDmR 433 439 M
Oxidation TGPVVTTTTVFGNEDLLmISSAGK 756 780 M
Oxidation TGPVVTTTTVFGNEDLLmISSAGKIVR 756 783 M
Methylation KNtSGVKLIk 793 803 K
Methylation KNTsGVKLIk 793 803 K
Phosphorylation KNTsGVKLIk 793 803 S
Phosphorylation KNtSGVKLIk 793 803 T
GENE/PROTEIN gyrA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-499 SSF56719 (IPR013760) DNA topoisomerase, type IIA, central Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003918'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; ('ATP' == '' ? '': 'ATP';-'hydrolyzing' == '' ? '': 'hydrolyzing';) 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003918) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
20-817 TIGR01063 (IPR005743) DNA gyrase, subunit A Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003918'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; ('ATP' == '' ? '': 'ATP';-'hydrolyzing' == '' ? '': 'hydrolyzing';) 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003918) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
23-475 SM00434 (IPR002205) DNA topoisomerase, type IIA, subunit A/C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003918'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; ('ATP' == '' ? '': 'ATP';-'hydrolyzing' == '' ? '': 'hydrolyzing';) 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003918) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
43-247 G3DSA:3.90.199.10 (IPR013758) DNA topoisomerase, type IIA, subunit A/ C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006259'>'DNA' == '' ? '': 'DNA'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006259) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003918'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; ('ATP' == '' ? '': 'ATP';-'hydrolyzing' == '' ? '': 'hydrolyzing';) 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003918) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
44-482 PF00521 (IPR002205) DNA topoisomerase, type IIA, subunit A/C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003918'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; ('ATP' == '' ? '': 'ATP';-'hydrolyzing' == '' ? '': 'hydrolyzing';) 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003918) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
51-211 PTHR10169 (n.a.) NULL 0.000000000740001
51-211 PTHR10169:SF2 (n.a.) NULL 0.000000000740001
248-343 G3DSA:3.30.1360.40 (IPR020899) Arginine repressor, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700)

4.1e-34
344-417 G3DSA:3.90.199.10 (IPR013758) DNA topoisomerase, type IIA, subunit A/ C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006259'>'DNA' == '' ? '': 'DNA'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006259) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003918'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; ('ATP' == '' ? '': 'ATP';-'hydrolyzing' == '' ? '': 'hydrolyzing';) 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003918) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
510-833 SSF101904 (n.a.) NULL 0
515-562 PF03989 (IPR006691) DNA gyrase/topoisomerase IV, subunit A, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003916'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003916) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0.00043
564-616 PF03989 (IPR006691) DNA gyrase/topoisomerase IV, subunit A, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003916'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003916) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0.00000038
621-665 PF03989 (IPR006691) DNA gyrase/topoisomerase IV, subunit A, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003916'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003916) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0.072
668-711 PF03989 (IPR006691) DNA gyrase/topoisomerase IV, subunit A, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003916'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003916) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0.0000027
720-760 PF03989 (IPR006691) DNA gyrase/topoisomerase IV, subunit A, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003916'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003916) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0.13
769-816 PF03989 (IPR006691) DNA gyrase/topoisomerase IV, subunit A, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006265'>'DNA' == '' ? '': 'DNA'; 'topological' == '' ? '': 'topological'; 'change' == '' ? '': 'change'; ('GO' == '' ? '': 'GO';:0006265)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005694'>'chromosome' == '' ? '': 'chromosome'; ('GO' == '' ? '': 'GO';:0005694)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003916'>'DNA' == '' ? '': 'DNA'; 'topoisomerase' == '' ? '': 'topoisomerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003916) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0.000000024
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
94 315 221 - Bacillus subtilis subsp. subtilis 1 223 <1e-50 56.9507 716
94 315 221 - Bacillus subtilis subsp. subtilis 1 223 <1e-50 56.9507 715
94 315 221 - Bacillus subtilis subsp. subtilis 1 223 <1e-50 56.9507 714
94 315 221 - Bacillus subtilis subsp. subtilis 1 223 <1e-50 56.9507 714
94 315 221 - Bacillus subtilis subsp. subtilis 1 223 <1e-50 56.0538 699
94 279 185 - Bacillus subtilis subsp. subtilis 1 187 <1e-50 56.6845 606
94 279 185 - Bacillus subtilis subsp. subtilis 1 187 <1e-50 56.6845 605
94 291 197 - Bacillus subtilis subsp. subtilis 1 199 <1e-50 56.7839 636
68 316 248 - Bacillus subtilis subsp. subtilis 1 250 <1e-50 58.4 832
68 316 248 - Bacillus subtilis subsp. subtilis 1 250 <1e-50 57.6 825
68 316 248 - Bacillus subtilis subsp. subtilis 1 250 <1e-50 58.4 831
50 355 305 - Bacillus subtilis subsp. subtilis 2 308 <1e-50 57.9805 1003
3 687 684 - MAG1830 Mycoplasma agalactiae 4 682 <1e-50 34.3977 1026
14 798 784 - MAG5630 Mycoplasma agalactiae 69 857 <1e-50 47.9193 1770
58 334 276 - Bacillus subtilis subsp. subtilis 1 278 <1e-50 55.3957 859
29 697 668 - MARTH_orf021 Mycoplasma arthritidis 25 696 <1e-50 36.2832 1083
14 798 784 - MARTH_orf662 Mycoplasma arthritidis 65 851 <1e-50 47.7157 1879
25 608 583 - Caulobacter crescentus NA1000 23 611 <1e-50 41.1862 1095
6 702 696 - Caulobacter crescentus NA1000 3 730 <1e-50 44.2466 1582
25 798 773 - MCJ_000540 Mycoplasma conjunctivae 70 845 <1e-50 46.2725 1832
20 697 677 - MCJ_005360 Mycoplasma conjunctivae 8 684 <1e-50 34.3109 1047
69 326 257 - Bacillus subtilis subsp. subtilis 1 259 <1e-50 57.1429 844
69 326 257 - Bacillus subtilis subsp. subtilis 1 259 <1e-50 57.1429 841
69 326 257 - Bacillus subtilis subsp. subtilis 1 259 <1e-50 57.1429 836
18 798 780 - MHO_4260 Mycoplasma hominis 76 860 <1e-50 46.8193 1818
10 702 692 - MHO_5120 Mycoplasma hominis 3 704 <1e-50 34.3706 1010
18 751 733 - Lactococcus lactis subsp. lactis KF147 2 735 <1e-50 36.8421 1179
22 798 776 - Lactococcus lactis subsp. lactis KF147 15 793 <1e-50 47.7535 1875
94 281 187 - Bacillus subtilis subsp. subtilis 1 189 <1e-50 56.6138 611
44 350 306 - Bacillus subtilis subsp. subtilis 1 308 <1e-50 58.4416 1013
44 348 304 - Bacillus subtilis subsp. subtilis 1 306 <1e-50 58.4967 1009
61 337 276 - Bacillus subtilis subsp. subtilis 1 278 <1e-50 56.8345 890
126 345 219 - Bacillus subtilis subsp. subtilis 2 222 <1e-50 52.4887 635
42 347 305 - Bacillus subtilis subsp. subtilis 1 307 <1e-50 58.3062 1010
46 347 301 - Bacillus subtilis subsp. subtilis 1 303 <1e-50 58.0858 993
45 347 302 - Bacillus subtilis subsp. subtilis 1 304 <1e-50 58.2237 999
33 751 718 - Bacillus subtilis subsp. subtilis 20 737 <1e-50 39.2808 1305
20 798 778 - Bacillus subtilis subsp. subtilis 9 789 <1e-50 47.3752 1914
33 751 718 - Bacillus subtilis subsp. subtilis 20 737 <1e-50 39.2808 1303
20 798 778 - b2231 Escherichia coli 8 822 <1e-50 43.6275 1679
21 682 661 - b3019 Escherichia coli 6 655 <1e-50 35.2941 975
1 839 838 - MG004 Mycoplasma genitalium 1 836 <1e-50 79.1418 3442
8 708 700 - MG204 Mycoplasma genitalium 1 691 <1e-50 32.3034 940
9 798 789 - MYCGA7230 Mycoplasma gallisepticum 7 798 <1e-50 57.197 2390
20 798 778 - Rv0006 Mycobacterium tuberculosis 15 801 <1e-50 41.6244 1623
493 599 106 - Rv0006 Mycobacterium tuberculosis 695 806 0.000007 29.8246 1623
33 708 675 - MCAP_0456 Mycoplasma capricolum subsp. capricolum 20 691 <1e-50 38.0323 1149
38 798 760 - MCAP_0040 Mycoplasma capricolum subsp. capricolum 1 764 <1e-50 43.268 1536
23 798 775 - MS53_0317 Mycoplasma synoviae 67 846 <1e-50 44.1741 1696
24 700 676 - MS53_0057 Mycoplasma synoviae 14 693 <1e-50 33.0925 946
3 798 795 - MHP7448_0528 Mycoplasma hyopneumoniae 7448 20 826 <1e-50 44.1286 1746
19 708 689 - MHP7448_0033 Mycoplasma hyopneumoniae 7448 7 695 <1e-50 33.2374 961
4 798 794 - MMOB4940 Mycoplasma mobile 57 855 <1e-50 48.0697 1928
24 707 683 - MMOB4600 Mycoplasma mobile 14 692 <1e-50 36.5747 1007
33 702 669 - MSC_0511 Mycoplasma mycoides subsp. mycoides SC 20 685 <1e-50 38.0741 1136
13 798 785 - MSC_0007 Mycoplasma mycoides subsp. mycoides SC 15 803 <1e-50 42.7848 1577
35 207 172 - LIC_13347 Leptospira interrogans serovar Copenhage 28 200 3e-27 36.3636 293
517 702 185 - LIC_10006 Leptospira interrogans serovar Copenhage 638 819 0.000001 22.6316 1535
23 798 775 - LIC_10006 Leptospira interrogans serovar Copenhage 35 814 <1e-50 40.641 1535
32 702 670 - MYCGA4190 Mycoplasma gallisepticum 18 683 <1e-50 37.2781 1050
43 347 304 - Bacillus subtilis subsp. subtilis 1 306 <1e-50 57.1895 986
43 347 304 - Bacillus subtilis subsp. subtilis 1 306 <1e-50 57.8431 1001
152 347 195 - Bacillus subtilis subsp. subtilis 1 197 <1e-50 51.269 539
41 347 306 - Bacillus subtilis subsp. subtilis 1 308 <1e-50 56.8182 982
41 347 306 - Bacillus subtilis subsp. subtilis 1 308 <1e-50 56.4935 978
1 702 701 - MYPE6470 Mycoplasma penetrans 1 694 <1e-50 34.5938 1014
8 798 790 - MYPE40 Mycoplasma penetrans 7 810 <1e-50 54.2289 2267
45 352 307 - Bacillus subtilis subsp. subtilis 1 309 <1e-50 58.2524 1013
39 344 305 - Bacillus subtilis subsp. subtilis 1 307 <1e-50 58.3062 1008
68 314 246 - Bacillus subtilis subsp. subtilis 6 253 <1e-50 58.0645 822
11 708 697 - Mycoplasma pulmonis 7 703 <1e-50 34.9929 1079
4 798 794 - Mycoplasma pulmonis 45 843 <1e-50 47.8152 1923
External IDs
COG
COG0188L
EC number
5.99.1.3
Gene ID
877234
GI
13507743
GO
DNA replication, recombination and repair
Home COG
L
InterPro
IPR002205|DNA topoisomerase, type IIA, subunit A or C-terminal
InterPro
IPR013758|DNA topoisomerase, type IIA, subunit A or C-terminal, alpha-beta
InterPro
IPR005743|DNA gyrase, subunit A
InterPro
IPR006691|DNA gyrase/topoisomerase IV, subunit A, C-terminal beta-pinwheel
InterPro
IPR013760|DNA topoisomerase, type IIA, central
Old MP number
MP150
Pathway
Division, DNA maintenance
PDB homologs
1suu_A
PDB homologs
1bgw_
PDB homologs
1ab4_
PDB homologs
1AB4
Pfam
PF03989
Pfam
PF00521
PID
g1673810
RefSeq
NP_109692.1
Swiss-Prot protein ID
GYRA_MYCPN
phylomeDB tree No orthologous found
UniProt
P22446
Transcription
IMAGE BROWSERS

OPERON OP2 (Genomic Overview)
Region:2800-11960

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn004STRING legend

PDB image(s)

1suu

PDB 1suu

1bgw

PDB 1bgw

1ab4

PDB 1ab4

1AB4

PDB 1AB4