Gene pyk (MPN303)
Name
pyk
Stable ID
MPN303
Location
356677 - 358203 +
Sequence
    1  ATGATTCACC ACCTAAAACG CACTAAGATT ATTGCCACCT GTGGTCCGGC TTTAACTAAA
   61  AAGCTATGAA CGCTAGCAAT GTTAGATGAC CCAGCTTACG CTGCGATGAA AGCAGAAGCT
  121  TACGCCAACA TTGAAAATAT TATTAAAAAC GGCGTAACGG TAATCCGCTT AAACTTCTCC
  181  CATGGTAACC ATGAAGAGCA GGCTGTAAGG ATTAAGATTG TTCGTGATGT GGCTAAAAAG
  241  CTCAACCTCC CGGTGTCAAT TATGTTAGAC ACCAACGGTC CGGAAATCCG CGTCTTTGAA
  301  ACGGCCCCTG AAGGGTTAAA GATCCTCAAG GACAGTGAGG TGGTTATTAA CACCACCACT
  361  AAGGAAGTGG CTAAAAATAA CCAGTTTAGT GTGAGTGATG CTAGTGGCAC TTACAACATG
  421  GTAAACGATG TTAAGGTGGG ACAAAAAATC CTCGTTGATG ATGGTAAGTT AAGCTTAGTC
  481  GTAAAGCGGA TTGATACGAA GAACAACCAG GTTATTTGTG TTGCCCAAAA TGACCACACT
  541  ATCTTTACCA AAAAGCGCTT AAACCTCCCC AATGCCGACT ACTCAATTCC CTTTTTAAGT
  601  GCTAAAGACC TACGCGACAT TGACTTTGGT TTAACCCACC AAATTGACTA CATTGCCGCT
  661  TCCTTTGTCA ATACAACGGA AAACATCAAG CAACTGCGTG ACTACCTCGC TTCTAAGAAT
  721  GCCAAGCATG TCAAGCTTAT TGCCAAAATT GAGTCCAACC ACGCTTTAAA CAACATTGAT
  781  GGGATTATTA AAGCGAGTGA TGGCATTATG GTAGCACGGG GTGATTTGGG CTTGGAGATC
  841  CCATATTACA AGGTGCCTTA CTGACAACGG TACATGATAA AAGCGTGTCG TTTCTTTAAC
  901  AAGCGTGTTA TTACCGCAAC TCAAATGTTG GACTCTTTGG AAAAAAACAT CCAACCAACT
  961  CGCGCTGAAG TTACTGATGT GTACTTTGCC GTGGACCGCG GCAATGATGC CACCATGTTA
 1021  AGTGGAGAAA CCGCAAATGG GGCGTTTCCC CTTAATGCTG TGTATGTAAT GAAGATGATT
 1081  GATAAACAGT CCGAAACGTT CTTTGATTAC CAGTACAACT TGAACTATTA CATGGCCAAC
 1141  TCCAAGGCCC GTCACAGTGA GTTTTGAAAG CAGGTGGTGT TACCGTTAGC ACAAAAAACA
 1201  GCACCAAAAC GCAAACTGAT TAACAGTGAC TTTAAATACG ACTTTGTGGT GCACGCCACC
 1261  AACAACCTTA ATGAAATCTA TGCCTTGTCC AACGCTCGCT TAGCGGCTGC GGTAATTATC
 1321  TTGACCAATG ACCCCCAAGT ATACACCGGG CACGGCGTTG ATTATGGCAT CTTCCCTTAC
 1381  TTAATTGACC AAAAGCCGCA AAGCTTAAGT AAAGCTGAGT TTAAGAGCTT AGCTAATGTT
 1441  GCCATTAAAC ACTACCAGCA GCATGGGGAA ATTAGTCAAT TAAAGCAGTG TTTGGGAGTA
 1501  TTTCACAATA AGATCATTAG CTTATAA
Download Sequence
Operon
OP120
Operon location
355675 - 358180
Protein (mpn303)
Name
Pyruvate kinase (PK) (EC 2.7.1.40)
Stable ID
Mpn303
Molecular Weight
55880
Isoelectric Point
10
Localization
SIGNALP
Comment -
Sequence
MIHHLKRTKIIATCGPALTKKLWTLAMLDDPAYAAMKAEAYANIENIIKNGVTVIRLNFSHGNHEEQAVRIKIVRDVAKK
LNLPVSIMLDTNGPEIRVFETAPEGLKILKDSEVVINTTTKEVAKNNQFSVSDASGTYNMVNDVKVGQKILVDDGKLSLV
VKRIDTKNNQVICVAQNDHTIFTKKRLNLPNADYSIPFLSAKDLRDIDFGLTHQIDYIAASFVNTTENIKQLRDYLASKN
AKHVKLIAKIESNHALNNIDGIIKASDGIMVARGDLGLEIPYYKVPYWQRYMIKACRFFNKRVITATQMLDSLEKNIQPT
RAEVTDVYFAVDRGNDATMLSGETANGAFPLNAVYVMKMIDKQSETFFDYQYNLNYYMANSKARHSEFWKQVVLPLAQKT
APKRKLINSDFKYDFVVHATNNLNEIYALSNARLAAAVIILTNDPQVYTGHGVDYGIFPYLIDQKPQSLSKAEFKSLANV
AIKHYQQHGEISQLKQCLGVFHNKIISL
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mIHHLKR 1 8 M
Oxidation KLWTLAmLDDPAYAAmK 21 38 M
Oxidation KLWTLAmLDDPAYAAMK 21 38 M
Oxidation KLWTLAMLDDPAYAAmK 21 38 M
Oxidation KLWTLAmLDDPAYAAmKAEAYANIENIIK 21 50 M
Oxidation KLWTLAmLDDPAYAAMKAEAYANIENIIKNGVTVIR 21 57 M
Oxidation KLWTLAmLDDPAYAAmKAEAYANIENIIKNGVTVIR 21 57 M
Oxidation LWTLAmLDDPAYAAMK 22 38 M
Oxidation LWTLAMLDDPAYAAmK 22 38 M
Oxidation LWTLAmLDDPAYAAmKAEAYANIENIIK 22 50 M
Oxidation KLNLPVSImLDTNGPEIR 80 98 M
Oxidation kLNLPVSImLDTNGPEIr 80 98 M
Oxidation KLNLPVSImLDTNGPEIRVFETAPEGLK 80 108 M
Oxidation LNLPVSImLDTNGPEIR 81 98 M
Oxidation EVAKNNQFSVSDASGTYNmVNDVK 122 146 M
Oxidation EVAKNNQFSVSDASGTYNmVNDVKVGQK 122 150 M
Oxidation NNQFSVSDASGTYNmVNDVK 126 146 M
Oxidation NNQFSVSDASGTYNmVNDVk 126 146 M
Oxidation NNQFSVSDASGTYNmVNDVKVGQK 126 150 M
Oxidation LIAKIESNHALNNIDGIIKASDGImVAR 246 274 M
Oxidation IESNHALNNIDGIIKASDGImVAR 250 274 M
Oxidation ASDGImVAr 265 274 M
Oxidation aSDGImVAR 265 274 M
Oxidation ASDGImVAR 265 274 M
Oxidation FFNKRVITATQmLDSLEK 298 316 M
Oxidation RVITATQmLDSLEK 302 316 M
Oxidation VITATQmLDSLEk 303 316 M
Oxidation VITATQmLDSLEK 303 316 M
Oxidation VITATQmLDSLEKNIQPTR 303 322 M
Oxidation MIDKQSETFFDYQYNLNYYmANSK 359 383 M
Oxidation mIDKQSETFFDYQYNLNYYMANSK 359 383 M
Oxidation mIDKQSETFFDYQYNLNYYmANSK 359 383 M
GENE/PROTEIN pyk (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
4-375 SSF51621 (IPR015813) Pyruvate/Phosphoenolpyruvate kinase Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

0
6-369 PF00224 (IPR015793) Pyruvate kinase, barrel Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
6-508 TIGR01064 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
7-96 G3DSA:3.20.20.60 (IPR015813) Pyruvate/Phosphoenolpyruvate kinase Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

0
7-489 PTHR11817 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
83-99 PR01050 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
94-196 SSF50800 (IPR011037) Pyruvate kinase-like, insert domain 5.00001e-19
97-197 G3DSA:2.40.33.10 (IPR015806) Pyruvate kinase, beta-barrel insert domain 6.4e-19
198-354 G3DSA:3.20.20.60 (IPR015813) Pyruvate/Phosphoenolpyruvate kinase Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

0
215-229 PR01050 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
244-256 PS00110 (IPR018209) Pyruvate kinase, active site 0
246-272 PR01050 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
273-297 PR01050 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
298-322 PR01050 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
323-341 PR01050 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
342-358 PR01050 (IPR001697) Pyruvate kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0
355-492 G3DSA:3.40.1380.20 (IPR015794) Pyruvate kinase, alpha/beta Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000287'>'magnesium' == '' ? '': 'magnesium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000287) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004743'>'pyruvate' == '' ? '': 'pyruvate'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004743) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0030955'>'potassium' == '' ? '': 'potassium'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0030955)

0.00000000029
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
6 423 417 - MAG1440 Mycoplasma agalactiae 6 397 <1e-50 43.3333 852
221 329 108 - Lactococcus lactis subsp. lactis KF147 192 296 0.0000000001 32.1101 146
1 458 457 - MARTH_orf034 Mycoplasma arthritidis 1 424 <1e-50 39.1775 843
6 365 359 - Caulobacter crescentus NA1000 5 333 <1e-50 32.7027 459
6 461 455 - MCJ_001920 Mycoplasma conjunctivae 10 434 <1e-50 42.7015 862
7 489 482 - MHO_4180 Mycoplasma hominis 7 453 <1e-50 39.9177 862
6 468 462 - Lactococcus lactis subsp. lactis KF147 3 456 <1e-50 33.3333 663
2 375 373 - Bacillus subtilis subsp. subtilis 1 349 <1e-50 39.4667 706
5 375 370 - Bacillus subtilis subsp. subtilis 1 346 <1e-50 39.7849 704
6 360 354 - Rv1617 Mycobacterium tuberculosis 3 329 <1e-50 34.8315 515
5 464 459 - b1676 Escherichia coli 1 422 <1e-50 34.9241 661
1 427 426 - b1854 Escherichia coli 1 420 1.4013e-45 31.2775 448
1 508 507 - MG216 Mycoplasma genitalium 1 508 <1e-50 76.7717 2088
4 463 459 - MCAP_0221 Mycoplasma capricolum subsp. capricolum 9 437 <1e-50 42.2414 887
6 461 455 - MS53_0648 Mycoplasma synoviae 7 432 <1e-50 41.886 904
6 458 452 - MHP7448_0126 Mycoplasma hyopneumoniae 7448 7 428 <1e-50 42.3841 863
6 458 452 - MMOB3210 Mycoplasma mobile 15 436 <1e-50 40.8994 837
4 463 459 - MSC_0261 Mycoplasma mycoides subsp. mycoides SC 9 437 <1e-50 42.0259 880
57 376 319 - LIC_11132 Leptospira interrogans serovar Copenhage 1 310 <1e-50 38.6293 534
5 372 367 - LIC_20264 Leptospira interrogans serovar Copenhage 8 349 <1e-50 36.8564 583
2 491 489 - MYCGA4790 Mycoplasma gallisepticum 10 496 <1e-50 55.102 1409
5 470 465 - MYPE780 Mycoplasma penetrans 4 468 <1e-50 46.5957 1110
6 461 455 - Mycoplasma pulmonis 6 430 <1e-50 42.3913 892
External IDs
EC number
2.7.1.40
Gene ID
877217
GI
13508042
GO
Carbohydrate transport and metabolism  
Home COG
G
InterPro
IPR001697|Pyruvate kinase
InterPro
IPR011037|Pyruvate kinase, beta-barrel-like
Old MP number
MP533
Pathway
Metabolism energy, Glycolysis
PDB homologs
1f3x_A
PDB homologs
1pkm_
PDB homologs
1a49_A
PDB homologs
1A3W-A
Pfam
PF00224
Pfam
PF03328
PID
g1674229
RefSeq
NP_109991.1
Swiss-Prot protein ID
KPYK_MYCPN
phylomeDB tree
KPYK_MYCPN
UniProt
P78031
Transcription
IMAGE BROWSERS

OPERON OP120 (Genomic Overview)
Region:355675-358180

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn303STRING legend

PDB image(s)

1f3x

PDB 1f3x

1pkm

PDB 1pkm

1a49

PDB 1a49

1A3W

PDB 1A3W