Gene mglA (MPN258)
Name
mglA
Stable ID
MPN258
Location
307996 - 309714 +
Sequence
    1  ATGTCAAAAA TAGCCTTCAG GATGGAAAAT ATCTGCAAGA GTTTTGACAA TGGTAGGGTC
   61  AAAGCTAATG TAGATGTTAA CCTCACGGTT TACGAAAATA CTGTCCACAC ATTGCTGGGT
  121  GAAAATGGTG CGGGCAAATC TACTTTAACT TCCATTTTGT TCGGTTTATA CCAACCCGAC
  181  AGCGGCAAAA TTTTTATTGG TGAAGAGGAA GTACACTTCA AGTCCTCCAA GGATGCCGTG
  241  CAGCACAAAA TTGGGATGGT GCACCAGCAC TTTAAGCTGG TTGATAACTA CACCGTCTTA
  301  GACAACATTA TTTTGGGCAA TGAAAGTAGT TTTTCCATTC CTTTTACCAA CGGTAAGCTT
  361  AAACTACCTT TATTGCACCG TAAAGCTAGC GAAGCCAAAA TTCAAGCAAT GATGGAACGG
  421  TATGACCTCC ATGTGAACTT GCACCAAAAG GTAAGCCGCT TAACGGTGGG TCAGCAACAA
  481  CGGGTCGAGA TCTTGAAGGT GTTATTCCGT GACAGTGACA TTCTCATCTT TGATGAACCA
  541  ACCGCTGTTT TGAGCGACCA GGAGATCAAG AGCTTTTTAA ACATCATTAA AAACTTCAAG
  601  AAGATGGGTA AAACGATTGT GCTCATCTCC CACAAACTCA ACGAAATTAA GGAAGTAGCG
  661  GAGACTGCTA CCATTTTGCG TCAAGGTCAC TCCGTTGGCA CCTTCCAAAT TAAGGACACT
  721  TCAATTGATG AAATGGCACG TTTAATGATG GGAAAGGAGT TGAAGGAAAC CAAAAACAAT
  781  ACTCAGTTTA CCGCCAAAGG TGAGCCCGTT TTAAAGGTCG AAAACCTCCA TCTTTATTTA
  841  AACCAAAACT GGTTTTACAA GTTAATTGCG CGCTGGAACC AAAAGCGAAT TAATCAACTC
  901  CAAAAACAGG GTAAGCCAGC GAAAACACTG TGGTTAAAGA GTTGACTAGA AGGGTTGGCA
  961  GCTATTGAAA AAACACCCCG TTTTATTCGT GGAATCGTTA ATAATTTAGG TTTTGGTAGC
 1021  CAACAGGTGT TTGATAAAGG GATTAGTTTT GAGATCCATA AGGGTGAAAT TTTTGCCATT
 1081  GCCGGGGTGG AAGGTAACGG TCAAAACCAA TTAATAGATC TTATTTGTGG CTTGGAAAAA
 1141  GCAGCACCAA AAAAGGTCTT CTTCAATGGT TTTGACATTT CACGTTATTC CATTCGCAAG
 1201  CGGATTAACG CTGGTATTGG TTTTGTGTTA GAAGACCGCC ATAAATACGG ATTAATCTTA
 1261  GACCAAACGG TGCGTTTTAA CGCGGTGAAT AACCAAATTG ATCGTAAGCA ATTTAGCAGT
 1321  TGAAATTTTT TAAATCAAAT GCAAATAGCT GTTTACACTA ACCAAATCGT CGATAAATTT
 1381  GATGTTCGTG GAGCGGTACA AGGTACAGCA ATAGTGCGTT TACTTTCCGG GGGTAATCAG
 1441  CAAAAGCTGA TTATTGGTCG GGAACTGACA AAGCAGAACG AGCTGTTAGT GTTTGCTCAA
 1501  GTAACCCGGG GTTTGGATGT TGGTGCCATT TCGTTTATCC ACCAAAAGAT TTTGGATGCA
 1561  AAGAAACAAA ATAATGCAAT CTTGTTAGTG TCATATGAGT TAGATGAAAT TTTAGCTATT
 1621  GCCGATACCA TTGGCGTAAT TAACAAAGGC AACCTGTTGG AAGTCAATAA ACGTGATGTA
 1681  ATGACGCGTG AACGCATAGG CAAACTAATC ATGCAATAA
Download Sequence
Operon
OP103
Operon location
307970 - 315844
Protein (mpn258)
Name
Sugar (ribose/galactose) ABC transporter ATP-binding subunit
Stable ID
Mpn258
Molecular Weight
62920
Isoelectric Point
10
Localization
Cytoplasm
Comment -
Sequence
MSKIAFRMENICKSFDNGRVKANVDVNLTVYENTVHTLLGENGAGKSTLTSILFGLYQPDSGKIFIGEEEVHFKSSKDAV
QHKIGMVHQHFKLVDNYTVLDNIILGNESSFSIPFTNGKLKLPLLHRKASEAKIQAMMERYDLHVNLHQKVSRLTVGQQQ
RVEILKVLFRDSDILIFDEPTAVLSDQEIKSFLNIIKNFKKMGKTIVLISHKLNEIKEVAETATILRQGHSVGTFQIKDT
SIDEMARLMMGKELKETKNNTQFTAKGEPVLKVENLHLYLNQNWFYKLIARWNQKRINQLQKQGKPAKTLWLKSWLEGLA
AIEKTPRFIRGIVNNLGFGSQQVFDKGISFEIHKGEIFAIAGVEGNGQNQLIDLICGLEKAAPKKVFFNGFDISRYSIRK
RINAGIGFVLEDRHKYGLILDQTVRFNAVNNQIDRKQFSSWNFLNQMQIAVYTNQIVDKFDVRGAVQGTAIVRLLSGGNQ
QKLIIGRELTKQNELLVFAQVTRGLDVGAISFIHQKILDAKKQNNAILLVSYELDEILAIADTIGVINKGNLLEVNKRDV
MTRERIGKLIMQ
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation IGmVHQHFK 84 93 M
Oxidation IGmVHQHFk 84 93 M
Oxidation QGHSVGTFQIKDTSIDEmAR 228 248 M
Oxidation DTSIDEmAr 239 248 M
Oxidation DTSIDEmAR 239 248 M
Oxidation IGKLImQ 566 573 M
GENE/PROTEIN mglA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
2-239 SSF52540 (n.a.) NULL 0
6-237 G3DSA:3.40.50.300 (n.a.) NULL 0
6-253 PS50893 (IPR003439) ABC transporter-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

0
6-262 PTHR19222:SF12 (n.a.) NULL 0
6-262 PTHR19222 (n.a.) NULL 0
32-230 SM00382 (IPR003593) ATPase, AAA+ type, core Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000166'>'nucleotide' == '' ? '': 'nucleotide'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000166) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0017111'>'nucleoside' == '' ? '': 'nucleoside';-'triphosphatase' == '' ? '': 'triphosphatase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0017111)

0.00000033
47-182 PF00005 (IPR003439) ABC transporter-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

1e-17
327-572 PS50893 (IPR003439) ABC transporter-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

0
338-559 G3DSA:3.40.50.300 (n.a.) NULL 0
346-565 SSF52540 (n.a.) NULL 3.59999e-34
475-489 PS00211 (IPR017871) ABC transporter, conserved site Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016887'>'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016887)

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
6 550 544 - b2149 Escherichia coli 14 482 <1e-50 31.0786 607
25 248 223 - b2149 Escherichia coli 281 501 0.000000000004 24 607
6 552 546 - b3567 Escherichia coli 5 483 <1e-50 30.1444 565
26 560 534 - b1513 Escherichia coli 30 491 <1e-50 27.1881 473
25 251 226 - b1513 Escherichia coli 281 502 0.0000000008 25.9574 473
346 552 206 - b1513 Escherichia coli 28 218 0.0000002 21.6346 473
25 551 526 - b2547 Escherichia coli 28 481 1.4013e-45 26.177 452
1 255 254 - b4087 Escherichia coli 1 247 6.00036e-42 36.8627 418
346 566 220 - b4087 Escherichia coli 280 502 3e-22 29.5154 418
6 229 223 - b4087 Escherichia coli 266 485 0.00000000003 23.2456 418
6 276 270 - b3749 Escherichia coli 5 263 1e-37 33.3333 381
322 569 247 - b3749 Escherichia coli 249 495 5e-23 32.1569 381
4 235 231 - b3749 Escherichia coli 256 477 0.00000000000003 25.8475 381
4 256 252 - b1900 Escherichia coli 8 247 5e-36 33.4646 367
348 552 204 - b1900 Escherichia coli 275 477 1e-17 30.4348 367
348 550 202 - b1900 Escherichia coli 26 219 0.00000000004 24.6377 367
6 254 248 - b4485 Escherichia coli 10 246 2e-35 31.3253 361
339 544 205 - b4485 Escherichia coli 274 472 2e-17 30.4348 361
27 242 215 - b4485 Escherichia coli 280 491 0.000000006 23.6607 361
25 229 204 - b3455 Escherichia coli 23 230 4e-23 28.3654 257
5 232 227 - b1917 Escherichia coli 3 223 5e-21 28.27 238
347 554 207 - b1917 Escherichia coli 21 224 0.000000002 22.7907 238
1 220 219 - b1117 Escherichia coli 1 213 3e-20 27.8761 231
6 229 223 - b0199 Escherichia coli 2 217 1e-19 26.5217 226
348 554 206 - b0199 Escherichia coli 24 221 0.000000001 23.1481 226
8 249 241 - b0262 Escherichia coli 9 233 2e-19 27.572 224
338 570 232 - b0262 Escherichia coli 16 233 0.00000000000006 23.6287 224
4 230 226 - b4287 Escherichia coli 1 215 4e-19 24.6696 222
4 229 225 - b2422 Escherichia coli 1 213 7e-19 30.0429 220
338 572 234 - b2422 Escherichia coli 12 235 0.000000000002 23.7903 220
18 232 214 - b0864 Escherichia coli 13 220 1e-18 28.6364 217
335 565 230 - b0864 Escherichia coli 9 232 0.0000006 21.9512 217
8 232 224 - b3271 Escherichia coli 15 226 3e-18 27.8761 214
346 559 213 - b3271 Escherichia coli 29 232 0.00000005 20.1794 214
10 229 219 - b0809 Escherichia coli 6 212 4e-18 26.6968 213
8 232 224 - b0652 Escherichia coli 4 215 1e-17 26.7544 209
7 230 223 - b4106 Escherichia coli 6 230 1e-17 28.4483 208
5 229 224 - b4035 Escherichia coli 3 210 2e-17 26.1062 207
343 557 214 - b4035 Escherichia coli 17 217 0.0000002 22.3684 207
7 230 223 - b3463 Escherichia coli 3 214 2e-17 27.3913 206
338 506 168 - b3463 Escherichia coli 12 169 0.00000000002 27.5862 206
6 229 223 - b0855 Escherichia coli 20 226 5e-17 27.4336 204
338 559 221 - b0855 Escherichia coli 29 235 0.000000000001 21.875 204
8 232 224 - b3454 Escherichia coli 1 216 8e-17 24.6753 202
4 238 234 - b0127 Escherichia coli 3 221 1e-16 25.3165 201
346 554 208 - b0127 Escherichia coli 22 216 0.0000000001 23.6967 201
25 232 207 - b2677 Escherichia coli 46 244 2e-16 30.0469 198
346 559 213 - b2677 Escherichia coli 45 250 0.0000000005 24.5536 198
1 559 558 - b0794 Escherichia coli 1 544 0.000000000000001 20.2658 192
18 232 214 - b2129 Escherichia coli 12 214 0.000000000000002 28.4404 191
6 232 226 - b0879 Escherichia coli 5 222 0.000000000000009 23.7069 184
346 553 207 - b0879 Escherichia coli 25 222 0.0000002 22.9358 184
20 250 230 - b1247 Escherichia coli 37 265 0.00000000000004 24.6862 179
46 229 183 - b2306 Escherichia coli 44 228 0.00000000000004 25.8537 179
7 229 222 - b1126 Escherichia coli 19 224 0.00000000000004 26.1062 178
18 251 233 - b0588 Escherichia coli 16 242 0.00000000000005 27.8481 178
8 211 203 - b4096 Escherichia coli 4 207 0.00000000000005 28.5714 178
27 229 202 - b0066 Escherichia coli 19 206 0.00000000000006 28.3654 177
26 213 187 - b0495 Escherichia coli 29 207 0.00000000000009 28.4264 176
25 236 211 - b0449 Escherichia coli 359 559 0.00000000000009 29.3578 175
8 217 209 - b1756 Escherichia coli 4 198 0.0000000000002 25.2336 172
16 271 255 - b0366 Escherichia coli 10 244 0.0000000000005 23.9382 169
5 229 224 - b3450 Escherichia coli 3 211 0.0000000000009 23.0089 167
339 550 211 - b3450 Escherichia coli 15 211 0.000004 20.6278 167
4 225 221 - b0914 Escherichia coli 342 551 0.000000000001 25 167
346 554 208 - b0914 Escherichia coli 360 558 0.00000002 24.2857 167
5 230 225 - b1441 Escherichia coli 4 212 0.000000000001 23.2456 166
338 565 227 - b1441 Escherichia coli 14 227 0.0000007 23.6052 166
9 255 246 - b3201 Escherichia coli 7 240 0.000000000001 24.4 165
8 229 221 - b4524 Escherichia coli 6 211 0.000000000002 24.2152 165
2 229 227 - b0151 Escherichia coli 8 224 0.000000000003 27.2727 162
8 558 550 - b0829 Escherichia coli 15 548 0.000000000005 21.0256 161
3 235 232 - b0949 Escherichia coli 317 519 0.000000000007 25.5144 159
8 533 525 - b0949 Escherichia coli 6 496 0.00000003 22.7848 159
8 232 224 - b1858 Escherichia coli 7 198 0.00000000001 27.8761 158
26 211 185 - b2211 Escherichia coli 342 508 0.00000000001 30.3191 157
1 226 225 - b3195 Escherichia coli 11 218 0.00000000002 25.2174 154
26 232 206 - b1483 Escherichia coli 35 222 0.00000000003 23.4234 153
36 544 508 - b0820 Escherichia coli 30 505 0.0000000001 20.4044 148
5 220 215 - b0820 Escherichia coli 319 502 0.00000001 25.5708 148
2 215 213 - b3486 Escherichia coli 273 470 0.0000000001 25.5814 148
18 553 535 - b3486 Escherichia coli 23 486 0.0000000005 19.1882 148
1 554 553 - b2180 Escherichia coli 1 506 0.0000000002 20.9184 147
20 232 212 - b3540 Escherichia coli 35 241 0.0000000002 24.3243 147
347 559 212 - b3540 Escherichia coli 40 247 0.0000001 21.0762 147
25 519 494 - b4391 Escherichia coli 24 489 0.0000000005 20.9472 143
25 258 233 - b4391 Escherichia coli 341 546 0.000000002 24.1525 143
37 229 192 - b0933 Escherichia coli 41 209 0.0000000009 22.9592 141
15 232 217 - b1290 Escherichia coli 22 230 0.000000002 24.2009 139
2 230 228 - b3725 Escherichia coli 9 229 0.000000002 25.8333 138
348 554 206 - b3541 Escherichia coli 26 234 0.000000002 24.3243 138
3 229 226 - b0886 Escherichia coli 336 554 0.000000003 21.5517 137
25 234 209 - b3480 Escherichia coli 30 233 0.000000006 27.3973 134
25 230 205 - b0448 Escherichia coli 354 547 0.00000003 24.1546 128
1 232 231 - b4097 Escherichia coli 1 225 0.00000007 21.519 124
122 217 95 - b4058 Escherichia coli 803 896 0.0000004 31.3131 118
357 552 195 - b0765 Escherichia coli 26 207 0.0000009 27.3171 115
18 231 213 - b0490 Escherichia coli 18 214 0.000002 23.0415 113
3 229 226 - b0887 Escherichia coli 347 565 0.000004 24.6914 110
5 276 271 - MARTH_orf821 Mycoplasma arthritidis 3 262 <1e-50 48.1618 611
348 567 219 - MARTH_orf821 Mycoplasma arthritidis 274 503 <1e-50 42.1739 611
3 266 263 - MARTH_orf821 Mycoplasma arthritidis 254 527 0.0000000001 24.1259 611
348 553 205 - MARTH_orf821 Mycoplasma arthritidis 22 219 0.0000003 24.7619 611
25 255 230 - MARTH_orf625 Mycoplasma arthritidis 73 300 1e-19 28.0488 220
8 229 221 - MARTH_orf119 Mycoplasma arthritidis 73 284 1e-17 25.1101 202
346 552 206 - MARTH_orf119 Mycoplasma arthritidis 91 286 0.000000003 24.5283 202
19 238 219 - MARTH_orf575 Mycoplasma arthritidis 29 233 6e-16 26.1261 188
338 553 215 - MARTH_orf575 Mycoplasma arthritidis 28 227 0.000000003 24.6575 188
2 239 237 - MARTH_orf140 Mycoplasma arthritidis 17 236 0.000000000000002 25.1046 185
25 232 207 - MARTH_orf376 Mycoplasma arthritidis 21 215 0.000000000000002 30.9859 184
348 557 209 - MARTH_orf376 Mycoplasma arthritidis 22 219 0.0000000001 25 184
4 253 249 - MARTH_orf560 Mycoplasma arthritidis 15 244 0.000000000000003 27.6 182
347 553 206 - MARTH_orf560 Mycoplasma arthritidis 34 223 0.00000009 25.1185 182
4 253 249 - MARTH_orf539 Mycoplasma arthritidis 15 249 0.00000000000001 26.5625 176
37 245 208 - MARTH_orf110 Mycoplasma arthritidis 3 209 0.000000000005 23.1132 154
348 556 208 - MARTH_orf864 Mycoplasma arthritidis 90 295 0.00000000002 24.0741 148
25 239 214 - MARTH_orf864 Mycoplasma arthritidis 89 299 0.0000000007 26.3158 148
35 216 181 - MARTH_orf684 Mycoplasma arthritidis 406 576 0.0000000003 30.7692 139
346 554 208 - MARTH_orf684 Mycoplasma arthritidis 395 592 0.000002 24.424 139
8 211 203 - MARTH_orf877 Mycoplasma arthritidis 1 210 0.00000001 23.2068 125
25 253 228 - MARTH_orf685 Mycoplasma arthritidis 372 595 0.00000002 25.9414 123
348 563 215 - MARTH_orf685 Mycoplasma arthritidis 373 579 0.0000007 23.5556 123
336 416 80 - MARTH_orf836 Mycoplasma arthritidis 39 115 0.00000005 32.0988 120
5 103 98 - MARTH_orf836 Mycoplasma arthritidis 31 124 0.000002 29.2929 120
6 232 226 - MARTH_orf400 Mycoplasma arthritidis 49 282 0.0000002 25.8964 115
346 559 213 - MARTH_orf400 Mycoplasma arthritidis 70 288 0.000003 21.9298 115
25 209 184 - MARTH_orf637 Mycoplasma arthritidis 489 657 0.0000002 26.0204 115
124 217 93 - MARTH_orf512 Mycoplasma arthritidis 798 894 0.0000007 27.8351 110
115 229 114 - MARTH_orf631 Mycoplasma arthritidis 198 312 0.000002 29.1667 105
10 106 96 - MARTH_orf631 Mycoplasma arthritidis 21 112 0.000003 34.3434 105
5 271 266 - MAG0140 Mycoplasma agalactiae 6 263 <1e-50 50.1873 657
346 570 224 - MAG0140 Mycoplasma agalactiae 281 519 <1e-50 44.8133 657
4 229 225 - MAG0140 Mycoplasma agalactiae 264 499 0.000000005 26.2097 657
348 553 205 - MAG0140 Mycoplasma agalactiae 25 224 0.00001 23.3333 657
7 245 238 - MAG1630 Mycoplasma agalactiae 5 215 7e-18 30 205
348 559 211 - MAG1630 Mycoplasma agalactiae 22 213 0.0000004 24.5455 205
4 211 207 - MAG7430 Mycoplasma agalactiae 119 317 5e-17 25.7009 197
346 560 214 - MAG7430 Mycoplasma agalactiae 141 346 0.00000006 22.7273 197
36 286 250 - MAG0290 Mycoplasma agalactiae 11 237 1e-16 24.6154 194
15 234 219 - MAG5180 Mycoplasma agalactiae 11 217 4e-16 28.4444 189
348 553 205 - MAG5180 Mycoplasma agalactiae 22 215 0.000000001 25 189
25 230 205 - MAG4610 Mycoplasma agalactiae 23 212 0.000000000000003 26.7281 183
6 557 551 - MAG5960 Mycoplasma agalactiae 2 533 0.00000000000002 22.0564 174
25 232 207 - MAG5170 Mycoplasma agalactiae 25 244 0.0000000000005 25.641 163
22 229 207 - MAG6000 Mycoplasma agalactiae 373 566 0.00000000001 27.4038 151
79 218 139 - MAG2700 Mycoplasma agalactiae 134 268 0.000000002 30.7143 131
2 232 230 - MAG0350 Mycoplasma agalactiae 88 327 0.000000007 25.3968 127
38 230 192 - MAG3100 Mycoplasma agalactiae 398 578 0.00000003 25.5102 122
3 219 216 - MAG3110 Mycoplasma agalactiae 356 557 0.0000004 26.6968 112
5 103 98 - MAG5050 Mycoplasma agalactiae 45 138 0.0000006 31.3131 111
127 226 99 - MAG5050 Mycoplasma agalactiae 448 548 0.000003 27.7228 111
96 230 134 - MAG1250 Mycoplasma agalactiae 178 308 0.0000009 24.8227 109
475 559 84 - MAG0340 Mycoplasma agalactiae 282 367 0.000001 33.7209 108
133 248 115 - MAG3790 Mycoplasma agalactiae 810 928 0.000004 24.3697 103
5 570 565 - MCJ_007040 Mycoplasma conjunctivae 7 503 <1e-50 38.4348 871
2 251 249 - MCJ_007040 Mycoplasma conjunctivae 257 505 0.0000000002 23.4615 871
7 221 214 - MCJ_007200 Mycoplasma conjunctivae 3 199 1e-17 30.2752 202
346 547 201 - MCJ_007200 Mycoplasma conjunctivae 22 204 0.0000000004 30.0493 202
7 211 204 - MCJ_000740 Mycoplasma conjunctivae 3 189 3e-16 30.4762 191
25 215 190 - MCJ_004670 Mycoplasma conjunctivae 22 200 0.000000000000005 28.0612 180
333 553 220 - MCJ_004670 Mycoplasma conjunctivae 4 216 0.00000000009 23.6842 180
7 229 222 - MCJ_004680 Mycoplasma conjunctivae 4 234 0.00000000000007 26.1224 170
20 211 191 - MCJ_004660 Mycoplasma conjunctivae 82 262 0.0000000000003 25 165
330 566 236 - MCJ_004660 Mycoplasma conjunctivae 69 295 0.0000002 22.6337 165
2 229 227 - MCJ_000370 Mycoplasma conjunctivae 3 212 0.000000000001 23.2456 160
7 558 551 - MCJ_005980 Mycoplasma conjunctivae 3 535 0.000000000002 22.1088 159
16 119 103 - MCJ_000160 Mycoplasma conjunctivae 42 134 0.00000000001 38.4615 151
124 251 127 - MCJ_000160 Mycoplasma conjunctivae 356 487 0.0000003 26.5152 151
25 232 207 - MCJ_004400 Mycoplasma conjunctivae 141 352 0.000000001 26.6376 133
346 565 219 - MCJ_002400 Mycoplasma conjunctivae 27 250 0.00000002 21.8884 123
60 211 151 - MCJ_000760 Mycoplasma conjunctivae 9 140 0.00000006 28.3871 119
1 218 217 - MCJ_000450 Mycoplasma conjunctivae 1 214 0.0000001 24.8908 117
475 555 80 - MCJ_004410 Mycoplasma conjunctivae 279 360 0.0000005 36.5854 111
157 229 72 - MCJ_004410 Mycoplasma conjunctivae 282 355 0.000003 35.1351 111
98 217 119 - MCJ_006650 Mycoplasma conjunctivae 790 902 0.000002 24.3902 107
7 229 222 - MCJ_003270 Mycoplasma conjunctivae 8 269 0.000006 22.3048 102
5 570 565 - MCAP_0037 Mycoplasma capricolum subsp. capricolum 10 510 <1e-50 40.9894 1017
27 256 229 - MCAP_0037 Mycoplasma capricolum subsp. capricolum 289 517 0.0000000000007 25.2101 1017
25 241 216 - MCAP_0730 Mycoplasma capricolum subsp. capricolum 24 237 9e-16 27.3973 187
6 234 228 - MCAP_0202 Mycoplasma capricolum subsp. capricolum 6 219 0.000000000000002 25.8621 185
342 555 213 - MCAP_0202 Mycoplasma capricolum subsp. capricolum 18 217 0.000000002 24.5536 185
1 229 228 - MCAP_0021 Mycoplasma capricolum subsp. capricolum 108 325 0.00000000000007 23.8298 171
346 550 204 - MCAP_0021 Mycoplasma capricolum subsp. capricolum 133 325 0.00000005 25.3589 171
6 229 223 - MCAP_0797 Mycoplasma capricolum subsp. capricolum 5 211 0.0000000000001 23.5808 170
36 235 199 - MCAP_0537 Mycoplasma capricolum subsp. capricolum 405 597 0.0000000000004 30.3318 165
353 558 205 - MCAP_0537 Mycoplasma capricolum subsp. capricolum 400 603 0.0000009 23.0415 165
1 241 240 - MCAP_0655 Mycoplasma capricolum subsp. capricolum 1 222 0.0000000000006 22.9508 163
335 560 225 - MCAP_0655 Mycoplasma capricolum subsp. capricolum 16 215 0.0000008 22.7468 163
1 232 231 - MCAP_0668 Mycoplasma capricolum subsp. capricolum 135 353 0.0000000000007 26.7782 162
277 557 280 - MCAP_0668 Mycoplasma capricolum subsp. capricolum 82 357 0.00000005 23.1034 162
8 211 203 - MCAP_0189 Mycoplasma capricolum subsp. capricolum 5 193 0.000000000004 25.8537 156
21 232 211 - MCAP_0667 Mycoplasma capricolum subsp. capricolum 25 230 0.00000000007 23.2877 145
25 219 194 - MCAP_0538 Mycoplasma capricolum subsp. capricolum 398 582 0.0000000001 29.064 143
35 229 194 - MCAP_0587 Mycoplasma capricolum subsp. capricolum 46 227 0.0000000003 24.3781 140
4 234 230 - MCAP_0119 Mycoplasma capricolum subsp. capricolum 64 303 0.0000000004 26.1905 138
3 230 227 - MCAP_0483 Mycoplasma capricolum subsp. capricolum 18 241 0.0000000005 24.2678 138
340 557 217 - MCAP_0483 Mycoplasma capricolum subsp. capricolum 35 247 0.000000008 26.1062 138
10 232 222 - MCAP_0826 Mycoplasma capricolum subsp. capricolum 6 231 0.000000002 25.5319 134
475 555 80 - MCAP_0120 Mycoplasma capricolum subsp. capricolum 256 337 0.000001 36.0465 108
27 229 202 - MCAP_0454 Mycoplasma capricolum subsp. capricolum 32 286 0.000002 21.0117 108
37 220 183 - MCAP_0123 Mycoplasma capricolum subsp. capricolum 33 223 0.000002 24.2718 106
5 570 565 - MYCGA5890 Mycoplasma gallisepticum 7 543 <1e-50 51.8389 1440
26 257 231 - MYCGA5890 Mycoplasma gallisepticum 317 551 0.0000000003 23.1405 1440
10 232 222 - MYCGA3760 Mycoplasma gallisepticum 11 217 1e-17 24.8889 204
2 215 213 - MYCGA2850 Mycoplasma gallisepticum 7 212 1e-17 29.2237 204
16 234 218 - MYCGA1030 Mycoplasma gallisepticum 15 216 2e-17 26.0274 202
339 559 220 - MYCGA1030 Mycoplasma gallisepticum 18 220 0.00000001 22.6087 202
7 256 249 - MYCGA5790 Mycoplasma gallisepticum 9 253 0.000000000000001 25.6604 187
335 565 230 - MYCGA5790 Mycoplasma gallisepticum 14 231 0.0000000000005 22.8448 187
7 221 214 - MYCGA2550 Mycoplasma gallisepticum 3 200 0.00000000000002 26.2673 175
8 256 248 - MYCGA0220 Mycoplasma gallisepticum 268 495 0.00000000000004 25.3906 173
346 559 213 - MYCGA0220 Mycoplasma gallisepticum 286 488 0.000004 21.0046 173
7 219 212 - MYCGA3660 Mycoplasma gallisepticum 359 559 0.0000000000002 26.7281 167
26 229 203 - MYCGA5780 Mycoplasma gallisepticum 45 247 0.000000000002 26.6968 159
347 553 206 - MYCGA5780 Mycoplasma gallisepticum 44 250 0.00000000004 25 159
6 229 223 - MYCGA0410 Mycoplasma gallisepticum 78 297 0.00000000005 25.3219 147
346 554 208 - MYCGA0410 Mycoplasma gallisepticum 96 301 0.0000002 24.6753 147
23 247 224 - MYCGA2190 Mycoplasma gallisepticum 23 244 0.0000000006 24.8908 137
348 564 216 - MYCGA2190 Mycoplasma gallisepticum 27 241 0.00000003 26.7857 137
1 215 214 - MYCGA2460 Mycoplasma gallisepticum 1 260 0.000000002 25.3676 133
2 106 104 - MYCGA4690 Mycoplasma gallisepticum 5 105 0.000000004 34.5794 130
3 217 214 - MYCGA0060 Mycoplasma gallisepticum 391 591 0.00000001 25.7919 125
332 525 193 - MYCGA0340 Mycoplasma gallisepticum 33 233 0.00000004 22.439 122
16 103 87 - MYCGA0340 Mycoplasma gallisepticum 40 124 0.00000005 36.3636 122
475 555 80 - MYCGA5170 Mycoplasma gallisepticum 295 376 0.000002 35.3659 106
122 247 125 - MYCGA0870 Mycoplasma gallisepticum 811 934 0.000003 24.8062 105
157 229 72 - MYCGA5130 Mycoplasma gallisepticum 684 757 0.000005 35.1351 103
1 572 571 - MG119 Mycoplasma genitalium 1 564 <1e-50 70.1049 2120
25 250 225 - MG179 Mycoplasma genitalium 26 239 3e-18 28.4519 207
348 565 217 - MG179 Mycoplasma genitalium 27 232 0.00000000002 24.8869 207
17 244 227 - MG180 Mycoplasma genitalium 31 251 4e-18 28.0851 206
349 554 205 - MG180 Mycoplasma genitalium 41 240 0.000000004 23.0415 206
8 229 221 - MG468.1 Mycoplasma genitalium 55 264 0.000000000000001 28.821 185
25 214 189 - MG467 Mycoplasma genitalium 107 285 0.0000000000001 22.1649 167
7 218 211 - MG015 Mycoplasma genitalium 353 552 0.0000000000006 28.2407 161
320 564 244 - MG015 Mycoplasma genitalium 340 576 0.000000000006 26.5625 161
25 232 207 - MG410 Mycoplasma genitalium 101 304 0.000000000009 24.6575 151
8 229 221 - MG065 Mycoplasma genitalium 235 446 0.0000000001 27.4678 141
346 552 206 - MG065 Mycoplasma genitalium 253 448 0.000000001 25.5924 141
36 184 148 - MG014 Mycoplasma genitalium 396 544 0.000000001 30.0654 133
2 105 103 - MG187 Mycoplasma genitalium 4 102 0.000000001 30.7692 132
23 214 191 - MG290 Mycoplasma genitalium 24 208 0.00000003 25.9067 121
8 106 98 - MG042 Mycoplasma genitalium 9 103 0.00000007 33.6634 117
339 406 67 - MG042 Mycoplasma genitalium 11 84 0.000002 36.4865 117
475 555 80 - MG042 Mycoplasma genitalium 348 429 0.000004 29.2683 117
29 239 210 - MG303 Mycoplasma genitalium 96 298 0.0000009 25.4464 108
319 553 234 - MG303 Mycoplasma genitalium 64 291 0.000001 25.1012 108
11 570 559 - MHP7448_0605 Mycoplasma hyopneumoniae 7448 13 502 <1e-50 39.7548 909
26 552 526 - MHP7448_0231 Mycoplasma hyopneumoniae 7448 1 460 <1e-50 26.4045 465
11 242 231 - MHP7448_0231 Mycoplasma hyopneumoniae 7448 244 474 0.0000001 23.4818 465
18 572 554 - MHP7448_0514 Mycoplasma hyopneumoniae 7448 17 505 <1e-50 27.2566 449
25 251 226 - MHP7448_0514 Mycoplasma hyopneumoniae 7448 285 509 0.0000000000001 26.383 449
8 221 213 - MHP7448_0021 Mycoplasma hyopneumoniae 7448 4 194 2e-19 30.0926 218
26 213 187 - MHP7448_0019 Mycoplasma hyopneumoniae 7448 20 186 9e-18 32.1053 204
7 221 214 - MHP7448_0305 Mycoplasma hyopneumoniae 7448 3 195 1e-17 30.2326 202
347 554 207 - MHP7448_0305 Mycoplasma hyopneumoniae 7448 19 207 0.00000002 26.6355 202
7 229 222 - MHP7448_0315 Mycoplasma hyopneumoniae 7448 3 203 2e-17 29.148 201
7 266 259 - MHP7448_0340 Mycoplasma hyopneumoniae 7448 3 231 5e-17 28.3525 198
340 557 217 - MHP7448_0340 Mycoplasma hyopneumoniae 7448 12 209 0.00000003 27.5556 198
26 221 195 - MHP7448_0020 Mycoplasma hyopneumoniae 7448 20 194 7e-16 31.6583 188
7 221 214 - MHP7448_0314 Mycoplasma hyopneumoniae 7448 3 195 0.000000000000002 26.8519 185
25 220 195 - MHP7448_0210 Mycoplasma hyopneumoniae 7448 19 219 0.000000000000007 29.4931 180
1 229 228 - MHP7448_0469 Mycoplasma hyopneumoniae 7448 1 211 0.000000000000007 28.1385 179
7 221 214 - MHP7448_0306 Mycoplasma hyopneumoniae 7448 3 194 0.00000000000001 25.6881 178
7 215 208 - MHP7448_0263 Mycoplasma hyopneumoniae 7448 3 200 0.00000000000005 29.3023 172
342 566 224 - MHP7448_0263 Mycoplasma hyopneumoniae 7448 17 236 0.0000003 24.5833 172
7 232 225 - MHP7448_0264 Mycoplasma hyopneumoniae 7448 4 237 0.0000000000001 26.4822 168
7 221 214 - MHP7448_0383 Mycoplasma hyopneumoniae 7448 3 195 0.0000000000002 29.6804 167
26 229 203 - MHP7448_0024 Mycoplasma hyopneumoniae 7448 20 202 0.0000000000002 28.436 166
8 211 203 - MHP7448_0452 Mycoplasma hyopneumoniae 7448 63 257 0.0000000000003 24.2857 165
25 253 228 - MHP7448_0361 Mycoplasma hyopneumoniae 7448 29 253 0.0000000000004 27.1552 164
25 221 196 - MHP7448_0023 Mycoplasma hyopneumoniae 7448 19 194 0.000000000002 27.2277 158
19 214 195 - MHP7448_0628 Mycoplasma hyopneumoniae 7448 349 525 0.000000002 27.551 132
14 103 89 - MHP7448_0369 Mycoplasma hyopneumoniae 7448 45 131 0.000000002 35.5556 132
131 234 103 - MHP7448_0369 Mycoplasma hyopneumoniae 7448 482 591 0.000001 29.4643 132
336 416 80 - MHP7448_0369 Mycoplasma hyopneumoniae 7448 46 122 0.000002 32.0988 132
6 269 263 - MHP7448_0502 Mycoplasma hyopneumoniae 7448 10 282 0.0000003 24.5614 114
346 565 219 - MHP7448_0502 Mycoplasma hyopneumoniae 7448 31 254 0.0000003 21.3043 114
40 214 174 - MHP7448_0624 Mycoplasma hyopneumoniae 7448 350 505 0.000001 27.5281 108
97 229 132 - MHP7448_0542 Mycoplasma hyopneumoniae 7448 180 308 0.000004 23.5294 104
319 406 87 - MHP7448_0542 Mycoplasma hyopneumoniae 7448 1 87 0.000005 30.6818 104
136 229 93 - MHP7448_0215 Mycoplasma hyopneumoniae 7448 272 357 0.000005 29.4737 103
8 229 221 - MHO_3520 Mycoplasma hominis 92 303 2e-19 27.897 218
346 555 209 - MHO_3520 Mycoplasma hominis 110 308 0.00000001 25.5814 218
25 233 208 - MHO_1970 Mycoplasma hominis 21 216 8e-17 31.3084 195
339 553 214 - MHO_1970 Mycoplasma hominis 13 215 0.0000000009 23.2877 195
25 232 207 - MHO_4360 Mycoplasma hominis 31 222 0.000000000000001 30.2326 186
348 553 205 - MHO_4360 Mycoplasma hominis 32 222 0.0000004 22.8571 186
25 229 204 - MHO_4960 Mycoplasma hominis 24 211 0.0000000000004 24.878 163
38 230 192 - MHO_2320 Mycoplasma hominis 388 567 0.00000000004 29.5337 146
25 232 207 - MHO_3570 Mycoplasma hominis 23 228 0.0000000001 21.8009 142
10 521 511 - MHO_3210 Mycoplasma hominis 6 493 0.0000000002 22.7273 139
38 229 191 - MHO_2310 Mycoplasma hominis 399 585 0.000000001 27.8607 134
21 229 208 - MHO_3830 Mycoplasma hominis 376 576 0.000000001 27.6995 132
79 214 135 - MHO_1980 Mycoplasma hominis 137 261 0.00000002 29.7872 122
319 449 130 - MHO_0740 Mycoplasma hominis 28 148 0.00000006 28.0303 118
37 103 66 - MHO_0740 Mycoplasma hominis 60 123 0.000002 37.3134 118
6 269 263 - MHO_1540 Mycoplasma hominis 45 317 0.0000003 24.8227 113
7 216 209 - MHO_3820 Mycoplasma hominis 383 582 0.0000008 25 109
5 570 565 - MMOB0370 Mycoplasma mobile 4 497 <1e-50 40.949 1003
3 251 248 - MMOB0370 Mycoplasma mobile 255 499 0.00000000000005 24.4186 1003
6 569 563 - MMOB0140 Mycoplasma mobile 8 509 9.00054e-42 28.0822 411
25 258 233 - MMOB0140 Mycoplasma mobile 288 519 0.000000000002 28.9256 411
6 234 228 - MMOB4330 Mycoplasma mobile 11 226 3e-19 29.0598 217
348 566 218 - MMOB4330 Mycoplasma mobile 31 238 0.0000000009 24.3243 217
13 229 216 - MMOB3520 Mycoplasma mobile 339 548 0.0000000000007 27.4775 161
26 239 213 - MMOB4320 Mycoplasma mobile 26 244 0.000000000002 27.4262 158
7 229 222 - MMOB1960 Mycoplasma mobile 57 258 0.000000000002 29.386 158
292 569 277 - MMOB1960 Mycoplasma mobile 12 276 0.000000001 23.0241 158
7 230 223 - MMOB5100 Mycoplasma mobile 390 600 0.00000000008 25.2174 144
4 239 235 - MMOB0100 Mycoplasma mobile 31 262 0.0000000001 25.5144 143
339 568 229 - MMOB0100 Mycoplasma mobile 45 271 0.0000003 22.1757 143
8 211 203 - MMOB3870 Mycoplasma mobile 5 193 0.0000000002 24.2718 141
4 218 214 - MMOB5110 Mycoplasma mobile 348 549 0.00000005 23.8532 119
348 554 206 - MMOB5110 Mycoplasma mobile 368 563 0.000003 22.2222 119
126 219 93 - MMOB1810 Mycoplasma mobile 804 900 0.0000004 27.8351 112
96 229 133 - MMOB0480 Mycoplasma mobile 199 328 0.000004 24.4444 103
8 173 165 - MMOB0480 Mycoplasma mobile 35 197 0.000009 27.1676 103
5 571 566 - MSC_0010 Mycoplasma mycoides subsp. mycoides SC 10 511 <1e-50 42.9577 1095
27 260 233 - MSC_0010 Mycoplasma mycoides subsp. mycoides SC 289 521 0.0000000000003 23.6515 1095
25 252 227 - MSC_0789 Mycoplasma mycoides subsp. mycoides SC 24 248 3e-16 28.5714 191
6 234 228 - MSC_0224 Mycoplasma mycoides subsp. mycoides SC 6 219 0.000000000000002 25.431 184
342 555 213 - MSC_0224 Mycoplasma mycoides subsp. mycoides SC 18 217 0.000000002 24.5536 184
1 229 228 - MSC_0030 Mycoplasma mycoides subsp. mycoides SC 107 324 0.00000000000001 24.2553 178
346 550 204 - MSC_0030 Mycoplasma mycoides subsp. mycoides SC 132 324 0.00000002 25.4717 178
1 241 240 - MSC_0704 Mycoplasma mycoides subsp. mycoides SC 1 222 0.00000000000006 24.5902 172
335 560 225 - MSC_0704 Mycoplasma mycoides subsp. mycoides SC 16 215 0.00000008 23.176 172
36 235 199 - MSC_0435 Mycoplasma mycoides subsp. mycoides SC 408 600 0.000000000001 28.5714 161
21 233 212 - MSC_0717 Mycoplasma mycoides subsp. mycoides SC 39 245 0.000000000002 23.1818 158
25 245 220 - MSC_0323 Mycoplasma mycoides subsp. mycoides SC 23 226 0.000000000003 23.1441 157
10 232 222 - MSC_0078 Mycoplasma mycoides subsp. mycoides SC 6 231 0.000000000008 25.9574 153
1 232 231 - MSC_0718 Mycoplasma mycoides subsp. mycoides SC 135 353 0.00000000002 27.6596 150
277 557 280 - MSC_0718 Mycoplasma mycoides subsp. mycoides SC 82 357 0.000000002 24.8276 150
35 229 194 - MSC_0398 Mycoplasma mycoides subsp. mycoides SC 61 242 0.00000000005 25.3731 147
25 236 211 - MSC_0434 Mycoplasma mycoides subsp. mycoides SC 398 601 0.00000000007 27.9279 145
27 232 205 - MSC_0967 Mycoplasma mycoides subsp. mycoides SC 115 324 0.0000000002 26.484 142
475 557 82 - MSC_0487 Mycoplasma mycoides subsp. mycoides SC 129 210 0.00000002 36.1446 124
25 232 207 - MSC_0487 Mycoplasma mycoides subsp. mycoides SC 3 206 0.000004 22.6852 124
37 220 183 - MSC_0113 Mycoplasma mycoides subsp. mycoides SC 33 223 0.000002 24.7573 108
475 559 84 - MSC_0968 Mycoplasma mycoides subsp. mycoides SC 281 366 0.000002 34.4444 107
475 559 84 - MSC_0975 Mycoplasma mycoides subsp. mycoides SC 157 242 0.000002 34.4444 107
15 106 91 - MSC_0516 Mycoplasma mycoides subsp. mycoides SC 20 105 0.000004 28.4211 104
6 570 564 - MYPE5890 Mycoplasma penetrans 101 627 <1e-50 50.0885 1385
4 254 250 - MYPE5890 Mycoplasma penetrans 383 632 0.000000005 25 1385
347 571 224 - MYPE5890 Mycoplasma penetrans 120 335 0.0000002 24 1385
5 271 266 - MYPE9770 Mycoplasma penetrans 18 280 4e-18 28.6219 208
348 565 217 - MYPE9770 Mycoplasma penetrans 38 244 0.00000003 24.8869 208
6 229 223 - MYPE10280 Mycoplasma penetrans 59 272 1e-16 27.3913 197
346 555 209 - MYPE10280 Mycoplasma penetrans 79 277 0.000001 25.1163 197
18 234 216 - MYPE960 Mycoplasma penetrans 68 268 0.000000000000003 28.0543 183
338 559 221 - MYPE960 Mycoplasma penetrans 67 272 0.0000009 19.9115 183
7 230 223 - MYPE3080 Mycoplasma penetrans 80 283 0.000000000000004 28.5088 183
346 553 207 - MYPE3080 Mycoplasma penetrans 97 285 0.0000006 23.1132 183
10 232 222 - MYPE3560 Mycoplasma penetrans 80 285 0.000000000000005 27.6316 182
25 212 187 - MYPE3490 Mycoplasma penetrans 116 292 0.00000000000003 26.1538 175
298 570 272 - MYPE3490 Mycoplasma penetrans 74 327 0.000000000001 26.7361 175
4 211 207 - MYPE5570 Mycoplasma penetrans 150 383 0.00000000000004 25.7384 175
26 229 203 - MYPE3630 Mycoplasma penetrans 115 307 0.00000000000008 28.2297 172
337 554 217 - MYPE3630 Mycoplasma penetrans 105 311 0.000002 21.4912 172
10 229 219 - MYPE3030 Mycoplasma penetrans 377 579 0.000000000002 26.9911 160
348 565 217 - MYPE3030 Mycoplasma penetrans 393 594 0.000001 23.4234 160
25 217 192 - MYPE6610 Mycoplasma penetrans 21 211 0.000000000002 28.0788 160
6 215 209 - MYPE2200 Mycoplasma penetrans 344 533 0.000000000003 24.6512 158
6 229 223 - MYPE9350 Mycoplasma penetrans 40 259 0.000000000005 23.4783 156
341 554 213 - MYPE9350 Mycoplasma penetrans 55 263 0.0000003 20.4545 156
38 372 334 - MYPE3570 Mycoplasma penetrans 34 363 0.0000000001 24.1758 144
25 242 217 - MYPE7280 Mycoplasma penetrans 106 308 0.0000000002 28.7671 142
25 256 231 - MYPE1880 Mycoplasma penetrans 26 234 0.0000000003 23.1092 141
3 230 227 - MYPE7530 Mycoplasma penetrans 354 566 0.0000000004 24.6753 139
154 229 75 - MYPE9760 Mycoplasma penetrans 252 327 0.0000000009 36.8421 137
475 553 78 - MYPE9760 Mycoplasma penetrans 252 330 0.00000001 31.6456 137
25 266 241 - MYPE4090 Mycoplasma penetrans 376 597 0.000000001 27.1255 136
38 229 191 - MYPE4100 Mycoplasma penetrans 450 629 0.000000001 26.5306 136
346 565 219 - MYPE4100 Mycoplasma penetrans 436 644 0.00000001 21.5247 136
336 554 218 - MYPE2480 Mycoplasma penetrans 413 620 0.000000009 22.3744 128
7 215 208 - MYPE2210 Mycoplasma penetrans 349 536 0.0000003 24.186 115
38 234 196 - MYPE7540 Mycoplasma penetrans 380 566 0.000007 25.1256 103
347 557 210 - Lactococcus lactis subsp. lactis KF147 40 247 0.000002 21.4286 111
126 217 91 - Lactococcus lactis subsp. lactis KF147 800 894 0.000002 30.5263 111
3 221 218 - Lactococcus lactis subsp. lactis KF147 335 541 0.000001 26.5766 113
348 554 206 - Lactococcus lactis subsp. lactis KF147 357 552 0.0000008 21.9048 113
25 233 208 - Lactococcus lactis subsp. lactis KF147 49 230 0.0000001 22.381 120
8 233 225 - Lactococcus lactis subsp. lactis KF147 342 548 0.0000004 22.467 124
346 553 207 - Lactococcus lactis subsp. lactis KF147 358 547 0.00000005 25.3589 124
348 556 208 - Lactococcus lactis subsp. lactis KF147 25 230 0.000001 22.8311 128
26 230 204 - Lactococcus lactis subsp. lactis KF147 25 225 0.00000001 25 128
346 553 207 - Lactococcus lactis subsp. lactis KF147 356 552 0.000006 23.5577 130
5 233 228 - Lactococcus lactis subsp. lactis KF147 337 553 0.000000008 24.4635 130
339 559 220 - Lactococcus lactis subsp. lactis KF147 378 586 0.000000007 25.2252 131
1 251 250 - Lactococcus lactis subsp. lactis KF147 1 239 0.000000004 22.8346 133
346 554 208 - Lactococcus lactis subsp. lactis KF147 442 639 0.000006 20.7547 134
26 232 206 - Lactococcus lactis subsp. lactis KF147 444 638 0.000000003 25.1185 134
347 560 213 - Lactococcus lactis subsp. lactis KF147 33 242 0.000000006 21.7391 136
19 232 213 - Lactococcus lactis subsp. lactis KF147 23 234 0.000000002 24.4444 136
5 233 228 - Lactococcus lactis subsp. lactis KF147 349 566 0.000000001 21.5517 137
25 533 508 - Lactococcus lactis subsp. lactis KF147 21 499 0.0000000007 21.6364 139
37 229 192 - Lactococcus lactis subsp. lactis KF147 34 208 0.0000000005 26.2887 141
333 553 220 - Lactococcus lactis subsp. lactis KF147 7 219 0.0000001 25.7642 141
26 215 189 - Lactococcus lactis subsp. lactis KF147 26 203 0.0000000004 27.7228 141
342 550 208 - Lactococcus lactis subsp. lactis KF147 33 231 0.0000009 24.6512 141
25 232 207 - Lactococcus lactis subsp. lactis KF147 40 234 0.0000000004 25.1142 141
25 233 208 - Lactococcus lactis subsp. lactis KF147 19 212 0.0000000002 23.1132 145
1 213 212 - Lactococcus lactis subsp. lactis KF147 338 529 0.0000000001 29.2035 147
337 564 227 - Lactococcus lactis subsp. lactis KF147 9 212 0.00000001 24.0343 149
7 246 239 - Lactococcus lactis subsp. lactis KF147 2 214 0.00000000005 25.1029 149
6 228 222 - Lactococcus lactis subsp. lactis KF147 2 224 0.00000000001 28.1633 155
340 552 212 - Lactococcus lactis subsp. lactis KF147 361 562 0.0000000005 26.1682 158
25 234 209 - Lactococcus lactis subsp. lactis KF147 367 565 0.000000000005 26.1905 158
6 226 220 - Lactococcus lactis subsp. lactis KF147 7 217 0.000000000004 24.4635 159
1 232 231 - Lactococcus lactis subsp. lactis KF147 1 217 0.000000000002 21.4592 161
8 226 218 - Lactococcus lactis subsp. lactis KF147 6 209 0.000000000002 25.9091 162
6 257 251 - Lactococcus lactis subsp. lactis KF147 3 235 0.0000000000008 27.3438 165
25 228 203 - Lactococcus lactis subsp. lactis KF147 19 208 0.0000000000002 27.6699 169
348 554 206 - Lactococcus lactis subsp. lactis KF147 29 237 0.00000005 23.8938 170
4 232 228 - Lactococcus lactis subsp. lactis KF147 14 236 0.0000000000002 26.971 170
346 556 210 - Lactococcus lactis subsp. lactis KF147 21 217 0.000000008 23.8739 185
7 229 222 - Lactococcus lactis subsp. lactis KF147 6 211 0.000000000000004 25 185
335 556 221 - Lactococcus lactis subsp. lactis KF147 14 226 0.000001 21.1454 190
21 234 213 - Lactococcus lactis subsp. lactis KF147 20 227 9e-16 29.148 190
329 559 230 - Lactococcus lactis subsp. lactis KF147 7 215 0.00000000000001 27.5424 194
18 239 221 - Lactococcus lactis subsp. lactis KF147 15 216 3e-16 29.5964 194
25 234 209 - Lactococcus lactis subsp. lactis KF147 46 248 1e-16 29.4931 198
7 232 225 - Lactococcus lactis subsp. lactis KF147 3 225 1e-16 28.5714 198
4 228 224 - Lactococcus lactis subsp. lactis KF147 1 213 8e-17 25.9912 199
338 554 216 - Lactococcus lactis subsp. lactis KF147 16 221 0.000000000004 25.1121 206
35 220 185 - Lactococcus lactis subsp. lactis KF147 34 208 1e-17 28.877 206
15 211 196 - Lactococcus lactis subsp. lactis KF147 16 202 2e-19 27.9412 222
338 555 217 - Lactococcus lactis subsp. lactis KF147 11 220 0.000000000001 24.8889 228
7 236 229 - Lactococcus lactis subsp. lactis KF147 3 224 4e-20 29.661 228
348 552 204 - Lactococcus lactis subsp. lactis KF147 21 201 0.0000000002 26.2136 232
7 229 222 - Lactococcus lactis subsp. lactis KF147 4 199 1e-20 30.4933 232
6 254 248 - Lactococcus lactis subsp. lactis KF147 4 243 1e-20 29.9611 233
339 556 217 - Lactococcus lactis subsp. lactis KF147 16 220 0.000005 22.5108 239
10 244 234 - Lactococcus lactis subsp. lactis KF147 8 226 2e-21 30.2905 239
338 557 219 - Lactococcus lactis subsp. lactis KF147 15 223 0.000000000005 22.9437 246
1 235 234 - Lactococcus lactis subsp. lactis KF147 1 228 3e-22 28.3951 246
346 556 210 - Lactococcus lactis subsp. lactis KF147 25 242 0.0000002 23.4513 255
18 229 211 - Lactococcus lactis subsp. lactis KF147 18 236 3e-23 33.3333 255
10 256 246 - Lactococcus lactis subsp. lactis KF147 265 506 0.00000000002 24.7012 525
338 571 233 - Lactococcus lactis subsp. lactis KF147 16 239 0.00000000000001 26.9231 525
346 571 225 - Lactococcus lactis subsp. lactis KF147 276 500 7.00649e-45 38.9381 525
6 254 248 - Lactococcus lactis subsp. lactis KF147 7 243 <1e-50 45.7831 525
346 568 222 - LIC_12684 Leptospira interrogans serovar Copenhage 46 251 0.000000000003 27.0742 213
11 230 219 - LIC_12684 Leptospira interrogans serovar Copenhage 34 235 3e-18 29.5154 213
3 245 242 - LIC_11804 Leptospira interrogans serovar Copenhage 2 223 2e-17 27.7551 206
6 211 205 - LIC_11081 Leptospira interrogans serovar Copenhage 12 210 2e-16 26.4151 198
348 552 204 - LIC_10136 Leptospira interrogans serovar Copenhage 398 591 0.0000005 21.9512 198
3 219 216 - LIC_10136 Leptospira interrogans serovar Copenhage 376 580 2e-16 26.1261 198
338 553 215 - LIC_11544 Leptospira interrogans serovar Copenhage 14 216 0.00000004 22.8311 198
1 254 253 - LIC_11544 Leptospira interrogans serovar Copenhage 1 239 2e-16 26.0536 198
338 559 221 - LIC_12526 Leptospira interrogans serovar Copenhage 12 222 0.0000001 21.7573 198
4 234 230 - LIC_12526 Leptospira interrogans serovar Copenhage 1 220 2e-16 28.2051 198
338 553 215 - LIC_11858 Leptospira interrogans serovar Copenhage 15 221 0.000000001 22.8311 189
1 234 233 - LIC_11858 Leptospira interrogans serovar Copenhage 1 223 0.000000000000002 26.749 189
348 554 206 - LIC_13431 Leptospira interrogans serovar Copenhage 33 221 0.0000000007 25.9615 186
8 250 242 - LIC_13431 Leptospira interrogans serovar Copenhage 17 242 0.000000000000005 25.8065 186
338 535 197 - LIC_12428 Leptospira interrogans serovar Copenhage 21 208 0.000007 22.1675 183
10 209 199 - LIC_12428 Leptospira interrogans serovar Copenhage 16 202 0.00000000000001 27.4038 183
6 223 217 - LIC_10518 Leptospira interrogans serovar Copenhage 5 212 0.00000000000001 25.9912 182
347 565 218 - LIC_11495 Leptospira interrogans serovar Copenhage 21 224 0.0000001 23.5556 180
8 257 249 - LIC_11495 Leptospira interrogans serovar Copenhage 6 236 0.00000000000002 28 180
348 554 206 - LIC_12182 Leptospira interrogans serovar Copenhage 382 577 0.000000000002 26.8868 170
18 229 211 - LIC_12182 Leptospira interrogans serovar Copenhage 374 573 0.0000000000003 27.6995 170
1 229 228 - LIC_11824 Leptospira interrogans serovar Copenhage 1 226 0.0000000000008 26.6129 167
26 229 203 - LIC_12079 Leptospira interrogans serovar Copenhage 25 222 0.000000000002 27.4038 164
25 510 485 - LIC_10538 Leptospira interrogans serovar Copenhage 19 474 0.000000000002 22.7969 162
6 230 224 - LIC_12311 Leptospira interrogans serovar Copenhage 3 215 0.00000000001 25.431 156
339 554 215 - LIC_10580 Leptospira interrogans serovar Copenhage 398 602 0.00000002 25.5507 153
25 220 195 - LIC_10580 Leptospira interrogans serovar Copenhage 406 590 0.00000000003 29.5918 153
326 554 228 - LIC_10532 Leptospira interrogans serovar Copenhage 375 600 0.000000003 22.9839 149
10 217 207 - LIC_10532 Leptospira interrogans serovar Copenhage 389 585 0.00000000009 25.9615 149
1 229 228 - LIC_10351 Leptospira interrogans serovar Copenhage 1 210 0.0000000001 26.2931 149
7 232 225 - LIC_13385 Leptospira interrogans serovar Copenhage 3 230 0.0000000001 25 147
38 230 192 - LIC_11434 Leptospira interrogans serovar Copenhage 34 230 0.0000001 22.3881 133
348 552 204 - LIC_11434 Leptospira interrogans serovar Copenhage 22 231 0.000000007 24.8889 133
26 232 206 - LIC_13316 Leptospira interrogans serovar Copenhage 20 210 0.000000007 26.57 132
26 213 187 - LIC_10233 Leptospira interrogans serovar Copenhage 26 204 0.00000001 24.8705 131
16 211 195 - LIC_10631 Leptospira interrogans serovar Copenhage 18 208 0.000002 25.7426 112
25 548 523 - LIC_10948 Leptospira interrogans serovar Copenhage 19 473 0.000004 21.4022 108
5 278 273 - MS53_0137 Mycoplasma synoviae 6 270 <1e-50 46.5455 592
405 570 165 - MS53_0137 Mycoplasma synoviae 427 592 2e-40 48.7952 592
348 550 202 - MS53_0137 Mycoplasma synoviae 25 220 0.0000007 25.6039 592
25 232 207 - MS53_0130 Mycoplasma synoviae 22 212 2e-18 27.7512 210
25 239 214 - MS53_0659 Mycoplasma synoviae 22 223 2e-16 29.5455 192
348 566 218 - MS53_0659 Mycoplasma synoviae 23 230 0.000000000003 27.1111 192
4 229 225 - MS53_0657 Mycoplasma synoviae 6 216 9e-16 29.5652 187
348 572 224 - MS53_0657 Mycoplasma synoviae 26 239 0.000005 23.5808 187
38 240 202 - MS53_0660 Mycoplasma synoviae 38 252 0.00000000000001 26.7544 178
14 214 200 - MS53_0086 Mycoplasma synoviae 11 216 0.00000000000001 29.3839 176
8 211 203 - MS53_0612 Mycoplasma synoviae 152 346 0.0000000000004 25.2381 163
8 219 211 - MS53_0514 Mycoplasma synoviae 409 611 0.0000000000006 30.6306 162
4 234 230 - MS53_0187 Mycoplasma synoviae 82 321 0.000000000005 29.3173 154
25 229 204 - MS53_0507 Mycoplasma synoviae 376 567 0.000000000007 26.7943 153
7 230 223 - MS53_0513 Mycoplasma synoviae 347 565 0.00000000003 25 147
1 229 228 - MS53_0034 Mycoplasma synoviae 1 213 0.0000000002 26.6667 141
25 211 186 - MS53_0080 Mycoplasma synoviae 19 210 0.0000000002 24.8848 141
8 229 221 - MS53_0506 Mycoplasma synoviae 384 593 0.000000004 27.4262 130
16 103 87 - MS53_0330 Mycoplasma synoviae 53 137 0.00000003 37.0787 122
335 416 81 - MS53_0330 Mycoplasma synoviae 51 128 0.000002 29.2683 122
1 225 224 - MS53_0391 Mycoplasma synoviae 471 663 0.0000001 27.3128 116
27 229 202 - MS53_0383 Mycoplasma synoviae 28 277 0.0000007 22.8 110
8 112 104 - MS53_0102 Mycoplasma synoviae 45 145 0.000002 29.5238 106
143 229 86 - MS53_0508 Mycoplasma synoviae 223 310 0.00001 27.7778 100
3 232 229 - Rv1218c Mycobacterium tuberculosis 7 214 4e-17 28.2609 204
26 211 185 - Rv2564 Mycobacterium tuberculosis 26 201 8e-17 26.7016 202
16 554 538 - Rv1281c Mycobacterium tuberculosis 17 580 1e-16 23.3723 200
8 234 226 - MT1276 Mycobacterium tuberculosis 6 218 2e-16 28.5714 198
26 229 203 - Rv2397c Mycobacterium tuberculosis 25 213 2e-16 30.3318 198
348 557 209 - Rv2397c Mycobacterium tuberculosis 25 220 0.000000004 23.3184 198
24 229 205 - Rv1859 Mycobacterium tuberculosis 15 215 3e-16 26.6355 196
348 570 222 - Rv1859 Mycobacterium tuberculosis 17 238 0.000000000009 24.1667 196
26 211 185 - Rv0073 Mycobacterium tuberculosis 26 201 0.000000000000001 26.9841 192
2 232 230 - MT1505 Mycobacterium tuberculosis 8 216 0.00000000000002 24.569 182
329 550 221 - MT1505 Mycobacterium tuberculosis 14 213 0.00000006 22.467 182
4 221 217 - Rv2936 Mycobacterium tuberculosis 6 208 0.00000000000003 25.2294 180
7 212 205 - Rv0986 Mycobacterium tuberculosis 8 206 0.00000000000004 24.5283 178
337 571 234 - Rv0986 Mycobacterium tuberculosis 19 243 0.00000000007 27.1967 178
26 229 203 - Rv1747 Mycobacterium tuberculosis 338 528 0.00000000000004 22.9268 178
329 551 222 - Rv1747 Mycobacterium tuberculosis 321 529 0.00000008 23.7069 178
9 249 240 - Rv3758c Mycobacterium tuberculosis 5 225 0.00000000000006 24.7967 177
25 232 207 - Rv1348 Mycobacterium tuberculosis 628 822 0.0000000000002 28.7736 173
348 554 206 - Rv1348 Mycobacterium tuberculosis 629 823 0.0000008 22.5962 173
25 229 204 - MT2898 Mycobacterium tuberculosis 23 212 0.0000000000004 26.699 170
9 217 208 - Rv1349 Mycobacterium tuberculosis 335 532 0.0000000000005 24.1706 169
6 212 206 - MT1657 Mycobacterium tuberculosis 316 507 0.0000000000005 27.0142 169
1 229 228 - MT2098 Mycobacterium tuberculosis 1 212 0.0000000000006 25.2174 168
8 211 203 - MT3186 Mycobacterium tuberculosis 4 196 0.000000000006 22.3301 160
26 232 206 - MT3764 Mycobacterium tuberculosis 310 511 0.00000000003 25.5814 154
347 565 218 - MT3764 Mycobacterium tuberculosis 309 524 0.0000000004 26.0504 154
335 559 224 - Rv0194 Mycobacterium tuberculosis 340 553 0.00000000004 22.2222 153
14 232 218 - Rv0194 Mycobacterium tuberculosis 950 1156 0.00000001 25.2252 153
25 234 209 - Rv0194 Mycobacterium tuberculosis 352 551 0.000003 23.4742 153
25 230 205 - Rv1272c Mycobacterium tuberculosis 415 614 0.0000000001 25.1142 149
25 221 196 - MT1727 Mycobacterium tuberculosis 35 210 0.0000000002 24.3655 147
4 247 243 - Rv0655 Mycobacterium tuberculosis 26 260 0.0000000002 24.4094 146
320 561 241 - Rv0655 Mycobacterium tuberculosis 17 251 0.0000002 21.0938 146
26 232 206 - Rv2688c Mycobacterium tuberculosis 38 225 0.0000000005 25.1208 143
348 561 213 - Rv1273c Mycobacterium tuberculosis 355 558 0.000000002 23.3645 138
25 234 209 - Rv1273c Mycobacterium tuberculosis 354 552 0.0000001 23.4742 138
25 519 494 - Rv2477c Mycobacterium tuberculosis 23 487 0.00000001 20.5769 132
26 232 206 - Rv0933 Mycobacterium tuberculosis 40 241 0.00000004 21.7593 127
144 217 73 - Rv1638 Mycobacterium tuberculosis 833 909 0.000002 35.0649 112
18 221 203 - Rv0820 Mycobacterium tuberculosis 15 215 0.000003 22.3256 110
2 234 232 - Lactococcus lactis subsp. lactis KF147 5 239 0.000009 23.5772 104
18 232 214 - Lactococcus lactis subsp. lactis KF147 21 237 0.0000002 25 119
339 533 194 - Lactococcus lactis subsp. lactis KF147 14 209 0.0000001 23.3645 123
6 211 205 - Lactococcus lactis subsp. lactis KF147 4 208 0.00000006 25.2252 123
16 232 216 - Lactococcus lactis subsp. lactis KF147 10 196 0.00000003 24.2291 126
6 233 227 - Lactococcus lactis subsp. lactis KF147 333 545 0.00000001 22.5941 128
346 566 220 - Lactococcus lactis subsp. lactis KF147 20 235 0.000000006 25.9259 132
25 230 205 - Lactococcus lactis subsp. lactis KF147 405 604 0.000000003 24.5283 134
26 412 386 - Lactococcus lactis subsp. lactis KF147 25 379 0.0000000002 22.6829 149
26 229 203 - Lactococcus lactis subsp. lactis KF147 317 507 0.00000000006 23.7864 149
35 239 204 - Lactococcus lactis subsp. lactis KF147 30 216 0.00000000002 23.7864 153
3 217 214 - Lactococcus lactis subsp. lactis KF147 2 207 0.000000000006 25.6757 157
26 221 195 - Lactococcus lactis subsp. lactis KF147 20 204 0.000000000004 27.5862 159
8 221 213 - Lactococcus lactis subsp. lactis KF147 6 206 0.000000000002 24.3363 161
6 211 205 - Lactococcus lactis subsp. lactis KF147 4 197 0.000000000002 23.0769 162
25 211 186 - Lactococcus lactis subsp. lactis KF147 19 210 0.000000000001 27.5362 163
38 533 495 - Lactococcus lactis subsp. lactis KF147 34 495 0.0000000000003 20.8255 168
4 232 228 - Lactococcus lactis subsp. lactis KF147 1 209 0.0000000000002 23.913 170
337 550 213 - Lactococcus lactis subsp. lactis KF147 10 212 0.0000000001 25.5814 177
9 229 220 - Lactococcus lactis subsp. lactis KF147 5 212 0.00000000000003 28.9474 177
6 211 205 - Lactococcus lactis subsp. lactis KF147 2 192 0.000000000000003 25.7282 186
346 554 208 - Lactococcus lactis subsp. lactis KF147 24 220 0.0000002 23.6111 192
5 213 208 - Lactococcus lactis subsp. lactis KF147 3 201 6e-16 28.4404 192
346 564 218 - Lactococcus lactis subsp. lactis KF147 21 225 0.00000006 26.8722 196
7 229 222 - Lactococcus lactis subsp. lactis KF147 6 211 2e-16 28 196
25 251 226 - Lactococcus lactis subsp. lactis KF147 268 490 0.000000000004 23.8095 411
329 569 240 - Lactococcus lactis subsp. lactis KF147 251 487 7e-26 30.7054 411
7 256 249 - Lactococcus lactis subsp. lactis KF147 4 242 1.99993e-41 37.2 411
8 550 542 - Caulobacter crescentus NA1000 6 478 <1e-50 29.7101 540
38 265 227 - Caulobacter crescentus NA1000 290 515 0.00000000003 23.8298 540
9 229 220 - Caulobacter crescentus NA1000 5 215 3e-24 28.3186 265
346 550 204 - Caulobacter crescentus NA1000 20 215 0.000000001 22.5352 265
5 231 226 - Caulobacter crescentus NA1000 3 222 6e-23 29.4118 254
338 554 216 - Caulobacter crescentus NA1000 13 218 0.000000002 22.4771 254
2 229 227 - Caulobacter crescentus NA1000 11 221 1e-18 26.8398 217
3 250 247 - Caulobacter crescentus NA1000 24 248 3e-18 26.6932 213
338 553 215 - Caulobacter crescentus NA1000 36 231 0.00000002 20.2765 213
10 211 201 - Caulobacter crescentus NA1000 9 204 2e-16 26.4423 197
8 230 222 - Caulobacter crescentus NA1000 13 217 3e-16 26.4574 196
329 568 239 - Caulobacter crescentus NA1000 13 233 0.00000000000002 26.6932 196
5 232 227 - Caulobacter crescentus NA1000 4 211 0.000000000000002 25.7642 190
338 553 215 - Caulobacter crescentus NA1000 14 211 0.00000005 24.4444 190
18 230 212 - Caulobacter crescentus NA1000 13 214 0.000000000000004 28.3721 187
338 559 221 - Caulobacter crescentus NA1000 12 222 0.000000003 24.6637 187
7 232 225 - Caulobacter crescentus NA1000 16 229 0.00000000000001 22.1739 183
20 217 197 - Caulobacter crescentus NA1000 370 556 0.00000000000002 28.1407 181
338 563 225 - Caulobacter crescentus NA1000 366 580 0.0000003 22.2707 181
26 232 206 - Caulobacter crescentus NA1000 25 233 0.00000000000002 29.1667 181
8 258 250 - Caulobacter crescentus NA1000 13 249 0.00000000000003 25.5906 179
333 561 228 - Caulobacter crescentus NA1000 13 231 0.000000002 22.3629 179
26 300 274 - Caulobacter crescentus NA1000 46 293 0.00000000000004 23.2727 178
347 557 210 - Caulobacter crescentus NA1000 45 239 0.0000000003 23.9631 178
5 232 227 - Caulobacter crescentus NA1000 4 211 0.00000000000004 22.2707 178
3 253 250 - Caulobacter crescentus NA1000 373 615 0.00000000000004 27.4131 178
347 554 207 - Caulobacter crescentus NA1000 394 590 0.000005 21.1268 178
8 229 221 - Caulobacter crescentus NA1000 4 208 0.0000000000001 27.7533 174
5 245 240 - Caulobacter crescentus NA1000 8 225 0.0000000000003 23.4568 170
28 230 202 - Caulobacter crescentus NA1000 27 213 0.0000000000003 24.8804 170
338 552 214 - Caulobacter crescentus NA1000 16 214 0.0000002 24.3119 170
3 211 208 - Caulobacter crescentus NA1000 11 213 0.0000000000009 23.5023 167
1 242 241 - Caulobacter crescentus NA1000 1 229 0.000000000001 22.7642 166
1 229 228 - Caulobacter crescentus NA1000 5 221 0.000000000002 24.0343 163
338 553 215 - Caulobacter crescentus NA1000 17 224 0.000009 19.5455 163
1 215 214 - Caulobacter crescentus NA1000 1 203 0.000000000004 24.8848 161
14 232 218 - Caulobacter crescentus NA1000 407 614 0.00000000002 25.3394 154
339 567 228 - Caulobacter crescentus NA1000 341 558 0.0000000003 26.0684 144
37 229 192 - Caulobacter crescentus NA1000 361 541 0.00000002 24.8705 144
4 230 226 - Caulobacter crescentus NA1000 6 222 0.000000005 25.3219 134
18 229 211 - Caulobacter crescentus NA1000 54 262 0.000000005 23.348 134
26 220 194 - Caulobacter crescentus NA1000 518 699 0.000000009 25.3807 132
346 507 161 - Caulobacter crescentus NA1000 516 668 0.0000004 26.9461 132
37 217 180 - Caulobacter crescentus NA1000 388 557 0.00000002 24.8619 129
49 226 177 - Caulobacter crescentus NA1000 62 231 0.00000002 23.1183 129
323 555 232 - Caulobacter crescentus NA1000 17 239 0.000005 25.523 129
25 211 186 - Caulobacter crescentus NA1000 341 499 0.00000002 25.3968 128
5 212 207 - Caulobacter crescentus NA1000 342 533 0.00000005 22.8311 126
26 211 185 - Caulobacter crescentus NA1000 23 190 0.0000002 23.6559 121
16 230 214 - Caulobacter crescentus NA1000 14 205 0.0000003 21.7593 119
6 270 264 - Caulobacter crescentus NA1000 310 538 0.0000006 25.6506 116
38 211 173 - Caulobacter crescentus NA1000 32 200 0.000007 23.2432 116
26 211 185 - Caulobacter crescentus NA1000 33 207 0.000007 25 107
6 564 558 - Bacillus subtilis subsp. subtilis 5 492 <1e-50 38.3929 937
25 257 232 - Bacillus subtilis subsp. subtilis 275 505 0.00000000000002 25.2101 937
6 564 558 - Bacillus subtilis subsp. subtilis 5 492 <1e-50 38.5714 937
25 257 232 - Bacillus subtilis subsp. subtilis 275 505 0.00000000000001 25.6303 937
6 275 269 - Bacillus subtilis subsp. subtilis 3 260 5.04467e-44 36.6667 438
348 566 218 - Bacillus subtilis subsp. subtilis 270 485 1e-23 29.8643 438
17 251 234 - Bacillus subtilis subsp. subtilis 260 491 0.0000000000003 26.3374 438
337 556 219 - Bacillus subtilis subsp. subtilis 11 221 0.000000000004 25.3394 438
8 275 267 - Bacillus subtilis subsp. subtilis 5 260 2.00386e-43 36.5672 434
348 566 218 - Bacillus subtilis subsp. subtilis 270 485 3e-24 29.5455 434
25 251 226 - Bacillus subtilis subsp. subtilis 269 491 0.0000000000004 26.0684 434
337 556 219 - Bacillus subtilis subsp. subtilis 11 221 0.000000000004 25.3394 434
7 229 222 - Bacillus subtilis subsp. subtilis 3 212 3e-25 32.1429 277
338 554 216 - Bacillus subtilis subsp. subtilis 11 216 0.0000002 21.0762 277
7 229 222 - Bacillus subtilis subsp. subtilis 3 212 3e-25 32.1429 277
338 554 216 - Bacillus subtilis subsp. subtilis 11 216 0.0000002 21.0762 277
14 552 538 - Bacillus subtilis subsp. subtilis 16 501 1e-21 21.6216 245
8 552 544 - Bacillus subtilis subsp. subtilis 10 501 4e-21 21.3904 240
8 239 231 - Bacillus subtilis subsp. subtilis 11 234 2e-19 28.1513 227
17 239 222 - Bacillus subtilis subsp. subtilis 15 227 2e-19 29.0749 226
26 229 203 - Bacillus subtilis subsp. subtilis 20 212 3e-19 29.9517 225
346 554 208 - Bacillus subtilis subsp. subtilis 18 216 0.000000001 27.1429 225
26 229 203 - Bacillus subtilis subsp. subtilis 20 212 3e-19 30.4348 225
346 554 208 - Bacillus subtilis subsp. subtilis 18 216 0.000000006 26.6667 225
8 232 224 - Bacillus subtilis subsp. subtilis 4 219 3e-18 28.0172 215
346 560 214 - Bacillus subtilis subsp. subtilis 22 226 0.000001 21.9178 215
8 232 224 - Bacillus subtilis subsp. subtilis 4 219 3e-18 28.0172 215
346 560 214 - Bacillus subtilis subsp. subtilis 22 226 0.000001 21.9178 215
20 232 212 - Bacillus subtilis subsp. subtilis 18 216 7e-18 28.7037 213
346 553 207 - Bacillus subtilis subsp. subtilis 22 216 0.0000000001 22.381 213
8 253 245 - Bacillus subtilis subsp. subtilis 4 239 9e-18 29.7619 212
348 563 215 - Bacillus subtilis subsp. subtilis 21 225 0.000008 22.2727 212
26 229 203 - Bacillus subtilis subsp. subtilis 20 215 2e-17 27.8846 209
6 234 228 - Bacillus subtilis subsp. subtilis 4 218 3e-17 28.0172 207
6 234 228 - Bacillus subtilis subsp. subtilis 4 218 3e-17 28.0172 207
20 232 212 - Bacillus subtilis subsp. subtilis 18 216 4e-17 28.2407 206
346 553 207 - Bacillus subtilis subsp. subtilis 22 216 0.0000000001 22.8571 206
25 239 214 - Bacillus subtilis subsp. subtilis 27 220 7e-17 29.8643 204
8 234 226 - Bacillus subtilis subsp. subtilis 4 219 1e-16 28.6957 203
348 570 222 - Bacillus subtilis subsp. subtilis 21 232 0.000002 22.0264 203
1 307 306 - Bacillus subtilis subsp. subtilis 1 266 1e-16 25.7235 202
348 555 207 - Bacillus subtilis subsp. subtilis 24 215 0.0000002 25.8065 202
25 239 214 - Bacillus subtilis subsp. subtilis 27 220 2e-16 29.8643 201
8 230 222 - Bacillus subtilis subsp. subtilis 4 216 3e-16 28.3843 199
26 229 203 - Bacillus subtilis subsp. subtilis 24 210 3e-16 26.57 198
338 552 214 - Bacillus subtilis subsp. subtilis 15 212 0.00000001 23.8532 198
6 234 228 - Bacillus subtilis subsp. subtilis 2 215 4e-16 27.7056 198
338 563 225 - Bacillus subtilis subsp. subtilis 11 222 0.000000001 19.7368 198
13 229 216 - Bacillus subtilis subsp. subtilis 9 216 4e-16 26.7857 198
335 554 219 - Bacillus subtilis subsp. subtilis 8 220 0.000000001 24.8908 198
25 218 193 - Bacillus subtilis subsp. subtilis 24 204 4e-16 29.0816 197
6 232 226 - Bacillus subtilis subsp. subtilis 2 219 5e-16 24.7899 197
13 229 216 - Bacillus subtilis subsp. subtilis 9 216 5e-16 26.7857 196
335 554 219 - Bacillus subtilis subsp. subtilis 8 220 0.0000000009 24.8908 196
6 234 228 - Bacillus subtilis subsp. subtilis 2 215 7e-16 27.2727 196
346 563 217 - Bacillus subtilis subsp. subtilis 18 222 0.0000000006 20.4545 196
26 229 203 - Bacillus subtilis subsp. subtilis 39 225 7e-16 26.087 195
338 552 214 - Bacillus subtilis subsp. subtilis 30 227 0.00000002 23.3945 195
26 215 189 - Bacillus subtilis subsp. subtilis 28 205 8e-16 34.359 195
347 550 203 - Bacillus subtilis subsp. subtilis 27 218 0.000001 24.5192 195
8 229 221 - Bacillus subtilis subsp. subtilis 4 202 8e-16 27.3543 195
4 231 227 - Bacillus subtilis subsp. subtilis 337 548 9e-16 27.3913 195
340 551 211 - Bacillus subtilis subsp. subtilis 349 547 0.000008 23.7209 195
3 307 304 - Bacillus subtilis subsp. subtilis 2 265 0.000000000000001 25.2427 194
348 555 207 - Bacillus subtilis subsp. subtilis 23 214 0.0000002 25.5814 194
4 231 227 - Bacillus subtilis subsp. subtilis 337 548 0.000000000000002 27.3913 192
6 253 247 - Bacillus subtilis subsp. subtilis 5 242 0.000000000000002 26.5873 192
348 563 215 - Bacillus subtilis subsp. subtilis 24 228 0.000006 22.2727 192
8 211 203 - Bacillus subtilis subsp. subtilis 4 195 0.000000000000002 26.699 191
8 211 203 - Bacillus subtilis subsp. subtilis 4 195 0.000000000000002 26.699 191
6 234 228 - Bacillus subtilis subsp. subtilis 2 219 0.000000000000003 26.7241 190
347 563 216 - Bacillus subtilis subsp. subtilis 20 225 0.000006 22.1719 190
27 232 205 - Bacillus subtilis subsp. subtilis 25 221 0.000000000000003 28.7736 190
350 555 205 - Bacillus subtilis subsp. subtilis 26 223 0.000000006 22.9358 190
27 232 205 - Bacillus subtilis subsp. subtilis 53 249 0.000000000000003 28.7736 190
350 555 205 - Bacillus subtilis subsp. subtilis 54 251 0.000000004 22.9358 190
25 270 245 - Bacillus subtilis subsp. subtilis 20 261 0.000000000000005 25.0996 188
8 229 221 - Bacillus subtilis subsp. subtilis 4 202 0.000000000000007 26.009 187
35 230 195 - Bacillus subtilis subsp. subtilis 6 193 0.000000000000009 28.2178 186
8 239 231 - Bacillus subtilis subsp. subtilis 4 215 0.000000000000009 23.2759 186
338 550 212 - Bacillus subtilis subsp. subtilis 11 205 0.000000002 23.3945 186
7 248 241 - Bacillus subtilis subsp. subtilis 3 228 0.000000000000009 25.6198 186
338 569 231 - Bacillus subtilis subsp. subtilis 11 228 0.00000000000004 26.1603 186
6 232 226 - Bacillus subtilis subsp. subtilis 2 219 0.00000000000001 23.9496 186
25 270 245 - Bacillus subtilis subsp. subtilis 20 261 0.00000000000001 25.0996 185
4 239 235 - Bacillus subtilis subsp. subtilis 1 212 0.00000000000001 25.2101 185
22 275 253 - Bacillus subtilis subsp. subtilis 22 274 0.00000000000001 27.9412 184
30 215 185 - Bacillus subtilis subsp. subtilis 1 174 0.00000000000002 33.5079 184
25 232 207 - Bacillus subtilis subsp. subtilis 19 215 0.00000000000002 27.4419 184
4 239 235 - Bacillus subtilis subsp. subtilis 1 212 0.00000000000002 24.7899 184
8 239 231 - Bacillus subtilis subsp. subtilis 4 215 0.00000000000002 23.2759 183
338 550 212 - Bacillus subtilis subsp. subtilis 11 205 0.000000004 22.4771 183
22 275 253 - Bacillus subtilis subsp. subtilis 22 274 0.00000000000002 27.9412 183
25 232 207 - Bacillus subtilis subsp. subtilis 19 215 0.00000000000002 27.4419 183
26 245 219 - Bacillus subtilis subsp. subtilis 22 230 0.00000000000003 27.5556 181
336 550 214 - Bacillus subtilis subsp. subtilis 11 214 0.00000004 24.5455 181
25 218 193 - Bacillus subtilis subsp. subtilis 21 201 0.00000000000005 28.0612 180
26 245 219 - Bacillus subtilis subsp. subtilis 22 230 0.0000000000001 27.1111 176
336 550 214 - Bacillus subtilis subsp. subtilis 11 214 0.0000001 25.3219 176
25 216 191 - Bacillus subtilis subsp. subtilis 359 540 0.0000000000001 28.4264 176
1 233 232 - Bacillus subtilis subsp. subtilis 1 210 0.0000000000001 25.5319 176
348 568 220 - Bacillus subtilis subsp. subtilis 24 223 0.0000002 24.8889 176
15 230 215 - Bacillus subtilis subsp. subtilis 16 229 0.0000000000002 26.7857 174
15 230 215 - Bacillus subtilis subsp. subtilis 16 229 0.0000000000003 26.7857 173
11 239 228 - Bacillus subtilis subsp. subtilis 10 219 0.0000000000003 27.7778 173
348 560 212 - Bacillus subtilis subsp. subtilis 23 220 0.00000003 26.6055 173
18 232 214 - Bacillus subtilis subsp. subtilis 6 216 0.0000000000003 26.8398 173
335 556 221 - Bacillus subtilis subsp. subtilis 2 219 0.0000009 22.2707 173
25 239 214 - Bacillus subtilis subsp. subtilis 23 221 0.0000000000003 26.3889 172
25 239 214 - Bacillus subtilis subsp. subtilis 23 221 0.0000000000003 26.3889 172
18 232 214 - Bacillus subtilis subsp. subtilis 16 226 0.0000000000004 26.8398 172
335 561 226 - Bacillus subtilis subsp. subtilis 12 234 0.0000008 22.2222 172
25 216 191 - Bacillus subtilis subsp. subtilis 359 540 0.0000000000004 27.9188 172
1 221 220 - Bacillus subtilis subsp. subtilis 1 208 0.0000000000005 26.1261 171
19 263 244 - Bacillus subtilis subsp. subtilis 19 243 0.0000000000006 25.5061 170
19 263 244 - Bacillus subtilis subsp. subtilis 19 243 0.0000000000006 25.5061 170
6 246 240 - Bacillus subtilis subsp. subtilis 2 231 0.0000000000009 24.3802 169
337 508 171 - Bacillus subtilis subsp. subtilis 10 172 0.000006 24.3094 169
3 233 230 - Bacillus subtilis subsp. subtilis 2 209 0.000000000001 25.3219 168
348 568 220 - Bacillus subtilis subsp. subtilis 23 222 0.0000002 25.3333 168
6 229 223 - Bacillus subtilis subsp. subtilis 4 208 0.000000000001 24.6696 168
348 554 206 - Bacillus subtilis subsp. subtilis 22 212 0.0000007 19.0476 168
25 214 189 - Bacillus subtilis subsp. subtilis 349 525 0.000000000001 29.3814 167
1 221 220 - Bacillus subtilis subsp. subtilis 1 208 0.000000000002 26.5217 167
26 211 185 - Bacillus subtilis subsp. subtilis 42 218 0.000000000002 25.3886 166
25 214 189 - Bacillus subtilis subsp. subtilis 349 525 0.000000000002 28.866 165
26 211 185 - Bacillus subtilis subsp. subtilis 26 202 0.000000000003 25.7895 164
25 229 204 - Bacillus subtilis subsp. subtilis 21 216 0.000000000004 24.2718 163
336 561 225 - Bacillus subtilis subsp. subtilis 11 233 0.000003 22.9839 163
348 559 211 - Bacillus subtilis subsp. subtilis 361 561 0.000000000006 24.5283 162
14 229 215 - Bacillus subtilis subsp. subtilis 347 558 0.00000000002 27.5556 162
348 559 211 - Bacillus subtilis subsp. subtilis 340 540 0.000000000006 24.5283 162
14 229 215 - Bacillus subtilis subsp. subtilis 326 537 0.00000000001 27.5556 162
27 211 184 - Bacillus subtilis subsp. subtilis 29 204 0.000000000007 25.3968 161
27 211 184 - Bacillus subtilis subsp. subtilis 29 204 0.000000000007 25.3968 161
26 226 200 - Bacillus subtilis subsp. subtilis 23 211 0.000000000007 26.7327 161
26 226 200 - Bacillus subtilis subsp. subtilis 23 211 0.000000000007 26.7327 161
25 229 204 - Bacillus subtilis subsp. subtilis 21 216 0.00000000002 23.7864 158
336 561 225 - Bacillus subtilis subsp. subtilis 11 233 0.000003 22.9839 158
25 229 204 - Bacillus subtilis subsp. subtilis 21 210 0.00000000002 25.1208 158
25 229 204 - Bacillus subtilis subsp. subtilis 21 210 0.00000000002 25.1208 158
4 247 243 - Bacillus subtilis subsp. subtilis 366 589 0.00000000002 27.2 157
11 211 200 - Bacillus subtilis subsp. subtilis 9 202 0.00000000002 26.9231 156
11 211 200 - Bacillus subtilis subsp. subtilis 9 202 0.00000000005 26.4423 153
347 556 209 - Bacillus subtilis subsp. subtilis 38 243 0.00000000007 25.7919 152
18 229 211 - Bacillus subtilis subsp. subtilis 31 237 0.0000000009 25.2294 152
1 229 228 - Bacillus subtilis subsp. subtilis 1 232 0.00000000009 25.9109 152
7 229 222 - Bacillus subtilis subsp. subtilis 334 544 0.0000000001 24.4541 150
348 550 202 - Bacillus subtilis subsp. subtilis 352 544 0.0000002 23.6453 150
347 556 209 - Bacillus subtilis subsp. subtilis 38 243 0.0000000001 25.7919 150
18 229 211 - Bacillus subtilis subsp. subtilis 31 237 0.000000001 25.2294 150
7 229 222 - Bacillus subtilis subsp. subtilis 306 516 0.0000000001 24.7826 150
348 550 202 - Bacillus subtilis subsp. subtilis 324 516 0.00000005 24.1379 150
1 229 228 - Bacillus subtilis subsp. subtilis 1 232 0.0000000001 25.9109 150
26 232 206 - Bacillus subtilis subsp. subtilis 385 579 0.0000000002 27.6995 149
18 229 211 - Bacillus subtilis subsp. subtilis 20 227 0.0000000002 26.1062 149
18 229 211 - Bacillus subtilis subsp. subtilis 23 230 0.0000000002 26.1062 149
342 560 218 - Bacillus subtilis subsp. subtilis 27 231 0.0000000004 23.7885 146
1 230 229 - Bacillus subtilis subsp. subtilis 10 222 0.000000001 25.7511 146
25 214 189 - Bacillus subtilis subsp. subtilis 43 223 0.0000000007 25.6544 144
25 214 189 - Bacillus subtilis subsp. subtilis 21 201 0.0000000009 25.6544 143
9 221 212 - Bacillus subtilis subsp. subtilis 338 539 0.000000002 25.8216 141
335 554 219 - Bacillus subtilis subsp. subtilis 341 550 0.0000001 23.0769 141
25 217 192 - Bacillus subtilis subsp. subtilis 356 537 0.000000002 26.7327 139
25 245 220 - Bacillus subtilis subsp. subtilis 21 235 0.000000004 21.3043 138
25 245 220 - Bacillus subtilis subsp. subtilis 21 235 0.000000004 21.3043 138
26 232 206 - Bacillus subtilis subsp. subtilis 449 643 0.000000004 26.6667 137
346 564 218 - Bacillus subtilis subsp. subtilis 447 655 0.0000001 24.5455 137
1 230 229 - Bacillus subtilis subsp. subtilis 10 222 0.000000004 25.9414 137
342 555 213 - Bacillus subtilis subsp. subtilis 27 226 0.000000005 22.973 137
25 215 190 - Bacillus subtilis subsp. subtilis 67 236 0.000000004 26.0417 137
348 547 199 - Bacillus subtilis subsp. subtilis 68 247 0.0000001 21.2871 137
9 232 223 - Bacillus subtilis subsp. subtilis 366 576 0.000000004 24.8889 137
26 232 206 - Bacillus subtilis subsp. subtilis 449 643 0.000000005 26.1905 136
346 564 218 - Bacillus subtilis subsp. subtilis 447 655 0.00000008 25 136
9 232 223 - Bacillus subtilis subsp. subtilis 366 576 0.000000005 24.8889 136
9 221 212 - Bacillus subtilis subsp. subtilis 347 548 0.000000005 25.3521 136
335 554 219 - Bacillus subtilis subsp. subtilis 350 559 0.0000002 23.0769 136
25 211 186 - Bacillus subtilis subsp. subtilis 19 210 0.000000007 26 135
25 211 186 - Bacillus subtilis subsp. subtilis 19 210 0.000000007 26 135
6 246 240 - Bacillus subtilis subsp. subtilis 2 231 0.000000007 24.3802 135
16 229 213 - Bacillus subtilis subsp. subtilis 33 218 0.000000008 26.6355 135
16 229 213 - Bacillus subtilis subsp. subtilis 33 218 0.000000008 26.6355 134
25 217 192 - Bacillus subtilis subsp. subtilis 356 537 0.000000009 26.2376 134
25 221 196 - Bacillus subtilis subsp. subtilis 345 530 0.00000001 27.1845 133
346 566 220 - Bacillus subtilis subsp. subtilis 18 219 0.00000002 22.3214 132
346 566 220 - Bacillus subtilis subsp. subtilis 18 219 0.00000002 22.3214 132
17 229 212 - Bacillus subtilis subsp. subtilis 15 201 0.00000002 22.5352 132
25 221 196 - Bacillus subtilis subsp. subtilis 345 530 0.00000002 27.1845 132
17 229 212 - Bacillus subtilis subsp. subtilis 15 201 0.00000002 22.5352 131
25 215 190 - Bacillus subtilis subsp. subtilis 22 191 0.00000003 26.4249 130
339 547 208 - Bacillus subtilis subsp. subtilis 14 202 0.0000001 20.8531 130
6 211 205 - Bacillus subtilis subsp. subtilis 4 213 0.00000004 26.087 128
6 211 205 - Bacillus subtilis subsp. subtilis 4 213 0.00000007 27.3913 126
38 239 201 - Bacillus subtilis subsp. subtilis 39 242 0.0000002 24.7706 123
38 239 201 - Bacillus subtilis subsp. subtilis 39 242 0.0000002 24.7706 123
3 220 217 - Bacillus subtilis subsp. subtilis 323 504 0.000001 23.2877 117
6 243 237 - Bacillus subtilis subsp. subtilis 5 246 0.000001 23.0159 116
6 243 237 - Bacillus subtilis subsp. subtilis 5 246 0.000001 23.0159 116
3 220 217 - Bacillus subtilis subsp. subtilis 323 504 0.000001 23.2877 115
5 271 266 - Mycoplasma pulmonis 4 259 <1e-50 45.5224 555
348 570 222 - Mycoplasma pulmonis 276 508 <1e-50 47.6395 555
338 553 215 - Mycoplasma pulmonis 14 219 0.0000000001 26.8519 555
6 254 248 - Mycoplasma pulmonis 253 513 0.0000000006 23.97 555
4 572 568 - Mycoplasma pulmonis 7 510 3e-35 26.3889 356
16 256 240 - Mycoplasma pulmonis 277 519 0.000000008 25.2 356
7 245 238 - Mycoplasma pulmonis 5 224 4e-21 31.405 234
6 239 233 - Mycoplasma pulmonis 2 222 3e-18 30.8642 209
352 569 217 - Mycoplasma pulmonis 26 232 0.00000008 24.7748 209
6 232 226 - Mycoplasma pulmonis 5 214 2e-17 25.1101 201
7 184 177 - Mycoplasma pulmonis 3 163 3e-17 32.0225 200
10 211 201 - Mycoplasma pulmonis 72 264 5e-17 25 198
346 506 160 - Mycoplasma pulmonis 88 237 0.000003 26.1905 198
7 270 263 - Mycoplasma pulmonis 3 244 2e-16 26.7658 194
7 273 266 - Mycoplasma pulmonis 3 249 3e-16 24.8148 192
37 237 200 - Mycoplasma pulmonis 37 248 0.0000000000001 26.6667 168
6 544 538 - Mycoplasma pulmonis 2 513 0.000000000001 22.164 161
10 229 219 - Mycoplasma pulmonis 39 243 0.0000000001 22.5225 143
25 230 205 - Mycoplasma pulmonis 160 369 0.0000000005 26.6376 138
6 221 215 - Mycoplasma pulmonis 2 216 0.000000004 25 130
6 106 100 - Mycoplasma pulmonis 36 132 0.00000001 33.6634 125
26 218 192 - Mycoplasma pulmonis 4 194 0.00000006 27.5 120
7 215 208 - Mycoplasma pulmonis 69 260 0.00000009 27.1028 118
127 229 102 - Mycoplasma pulmonis 357 460 0.0000003 28.3019 114
133 229 96 - Mycoplasma pulmonis 220 317 0.0000004 29.2929 113
26 269 243 - Mycoplasma pulmonis 50 297 0.0000008 24.6212 110
External IDs
COG
COG3845R
Gene ID
876920
GI
13507997
GO
Carbohydrate transport and metabolism  
Home COG
G
InterPro
IPR003439|ABC Transporter related
InterPro
IPR003593|AAA ATPase
Old MP number
MP575
Pathway
ribose/galactose transport, subunit
Pathway
Transporters, ABC superfamily
PDB homologs
1l2t_A
PDB homologs
1b0u_A
PDB homologs
1oxs_C
Pfam
PF00005
PID
g1674275
RefSeq
NP_109946.1
Swiss-Prot protein ID
Y258_MYCPN
phylomeDB tree
Y258_MYCPN
UniProt
P75516
Transcription
IMAGE BROWSERS

OPERON OP103 (Genomic Overview)
Region:307970-315844

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn258STRING legend

PDB image(s)

1l2t

PDB 1l2t

1b0u

PDB 1b0u

1oxs

PDB 1oxs