Gene gatC (MPN236)
Name
gatC
Stable ID
MPN236
Location
287388 - 288827 +
Sequence
    1  ATGGATAAAT TAATAAATAA ACCTCAACCA TTAACTTCTG ATATTTCCAC TTCTGGATTT
   61  ATTTACTTTG CGGTTGTTTT TGTAGCCATT ATGGGCTACC TTTTATTCAA AAATCTACTG
  121  TTTTTATTTT TCTTTAAACG CTATCCAAAA AACACTCCCA AAATTGGGGT AGGTAACATT
  181  ACCACGATTG CCATGATCAT TGCTGTGGCG GTGTCGATTG TTTTAGTGTT AATGGCACTA
  241  GCAGGCGGTT TAGCCGCTGC TTTGTTCCGT GGTTATCCTG GTTTTCGGGT CACCTTGGAG
  301  TTAATCCTTG TAAAGATTTC GGGACTGTTG TTTGGTCCAA TTGTCGGCAT TTTTTCCGCG
  361  GCCACAATTG ACTTTTTAAC GGTCATCTTT TCGGGTGGGG TTTTTAACGT TGGTTATGTT
  421  TTAGGTGCCA TCTTAACCGG GATGATTGCT GGCATACTGC GTGAAGTTTT AATTTCAACA
  481  GCACTTTTAC ACAACCGTAA TTTATCGGAT TTTGCCTACC TAGTGCTCTC GATTGGCATG
  541  GTCATTGCCG CCTTTTTAAT TACCCAGTTC TTTGTGCTTG GGATAAGTAA TAACCTTAAG
  601  GAGATTAAGG GTGATGAAGA GTTTCGCTTG AAATTTAACG CACCATCAAT TGTCTTTGAG
  661  CTTTCGTTAA CCCAGTACGC CAACATTCTG CTCTACTTTA CCATTGCCAT AGTTATTGCT
  721  ATGCTGGTGT TGTACATTGT TTGGTTAGTC AAACAGCGTC ACTTAAGTTT TGAGCACTCT
  781  CGTTTCTTTT ACCGCAGTTA CAAACATGCT AATCACCAGT TTACCCTGTT TGTACTAACT
  841  AAGGAAAACT GGTTCTATTT AATCTTGAAT GTAATCACCT TAGCTTCCAC TAGTTTGTTG
  901  ATGATCAACA TTGCCTTCAT TCCGATCTTT GACACGCAAA CAACTGGTCA AACATACGAG
  961  TTTTGACTAT TAGCACGCTT ACTGTTCGCT CCCGTAATCT TCTTGTTGGA CATTATTGTG
 1021  ATCTATCCAA TTCTGCTGTT ATTAACCCCG CTAATGCTCA AAGGTTTTAA AACAGCAGTT
 1081  TCTAAAAACC AACGCAAAAC ACTAAAACAA AGCTTTACTG ATTTGCAAAG TGTAGTGTTG
 1141  CCCATTATTA ACAAACGTAA ACACCAGCAG TTGCGCCAAG AAGAGTTAAA ACGCTTAGCA
 1201  CGAGCCACTC ACTTTGATTT GACAGAAGGC GAAATGGAAA AGCTCTTGGT CGAATTTAAA
 1261  ACTATTACCC AGAGCTTTGA CCGGGTGATG AACATTGATA CCACCAGTGT GGAACCAATG
 1321  TACGCACCTT TCAATACATC ACCAACGCCA CTGCGTAAAG ATAAGGTAAT AGTGGAAAAG
 1381  CATCCCGAAA AATTATTAGC CAACTGTAAG GAAATGAGTG TTGGCTTTGT CAAAGTATAG
Download Sequence
Operon
OP97
Operon location
287260 - 291652
Protein (mpn236)
Name
Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-)
Stable ID
Mpn236
Molecular Weight
52690
Isoelectric Point
10
Localization
TMHMM
Comment Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln). GatC is at the C-terminus. This protein has an N-terminal domain fused with transmembrane segments of 347 aa of unknown function.
Sequence
MDKLINKPQPLTSDISTSGFIYFAVVFVAIMGYLLFKNLLFLFFFKRYPKNTPKIGVGNITTIAMIIAVAVSIVLVLMAL
AGGLAAALFRGYPGFRVTLELILVKISGLLFGPIVGIFSAATIDFLTVIFSGGVFNVGYVLGAILTGMIAGILREVLIST
ALLHNRNLSDFAYLVLSIGMVIAAFLITQFFVLGISNNLKEIKGDEEFRLKFNAPSIVFELSLTQYANILLYFTIAIVIA
MLVLYIVWLVKQRHLSFEHSRFFYRSYKHANHQFTLFVLTKENWFYLILNVITLASTSLLMINIAFIPIFDTQTTGQTYE
FWLLARLLFAPVIFLLDIIVIYPILLLLTPLMLKGFKTAVSKNQRKTLKQSFTDLQSVVLPIINKRKHQQLRQEELKRLA
RATHFDLTEGEMEKLLVEFKTITQSFDRVMNIDTTSVEPMYAPFNTSPTPLRKDKVIVEKHPEKLLANCKEMSVGFVKV
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation ATHFDLTEGEmEK 402 415 M
Oxidation TITQSFDRVMNIDTTSVEPmYAPFNTSPTPLRK 421 454 M
Oxidation TITQSFDRVmNIDTTSVEPMYAPFNTSPTPLRK 421 454 M
Methylation VMNIDTTSVEPMYAPFNTSPTPLRk 429 454 K
Oxidation VmNIDTTSVEPmYAPFNTSPTPLRK 429 454 M
Oxidation VMNIDTTSVEPmYAPFNTSPTPLRK 429 454 M
Oxidation VmNIDTTSVEPMYAPFNTSPTPLRK 429 454 M
Oxidation EmSVGFVKV 471 480 M
GENE/PROTEIN gatC (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
390-479 SSF141000 (n.a.) NULL 1.7e-16
391-479 TIGR00135 (IPR003837) Glu-tRNAGln amidotransferase, C subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006450'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'translational' == '' ? '': 'translational'; 'fidelity' == '' ? '': 'fidelity'; ('GO' == '' ? '': 'GO';:0006450)

0.0000000014
407-479 PF02686 (IPR003837) Glu-tRNAGln amidotransferase, C subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006450'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'translational' == '' ? '': 'translational'; 'fidelity' == '' ? '': 'fidelity'; ('GO' == '' ? '': 'GO';:0006450)

0.000000000011
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
93 152 59 - MCJ_007270 Mycoplasma conjunctivae 30 89 0.000002 36.6667 105
89 479 390 - MYCGA6080 Mycoplasma gallisepticum 83 458 9.80909e-45 30.1508 435
12 479 467 - MG098 Mycoplasma genitalium 10 477 <1e-50 60.0427 1486
93 152 59 - MHP7448_0670 Mycoplasma hyopneumoniae 7448 36 95 0.0000003 40 112
93 153 60 - MMOB1560 Mycoplasma mobile 36 96 0.000007 36.0656 101
89 333 244 - MYPE2080 Mycoplasma penetrans 92 320 0.00000000000003 26.07 175
93 153 60 - Mycoplasma pulmonis 51 111 0.000002 32.7869 105
External IDs
COG
COG0721J
EC number
6.3.5.7
Gene ID
877199
GI
13507975
GO
Translation, ribosomal structure and biogenesis
Home COG
J
InterPro
IPR003837|Glu-tRNAGln amidotransferase, C subunit
Old MP number
MP595
Pathway
Translation
PDB homologs
1mzb_A
Pfam
PF02686
PID
g1674297
RefSeq
NP_109924.1
Swiss-Prot protein ID
Y236_MYCPN
phylomeDB tree
Y236_MYCPN
UniProt
P75535
Transcription
IMAGE BROWSERS

OPERON OP97 (Genomic Overview)
Region:287260-291652

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn236STRING legend

PDB image(s)

1mzb

PDB 1mzb