Gene rpoA (MPN191)
Name
rpoA
Stable ID
MPN191
Location
231448 - 232431 +
Sequence
    1  ATGGAAAAGT TTTTAAAGTA CGAAATAAAG GTAAATAACG AACAAGCACG CGCTAACCCC
   61  AACTACGGCA TCTTTGAAGT TGGACCACTC GAATCGGGCT TTGTCATTAC CATCGGTAAT
  121  GCTATGCGCC GGGTGCTGTT GAGCTGTATT CCAGGTGCCA GTGTGTTTGC ACTCTCAATT
  181  TCGGGTGCCA AGCAAGAGTT TGCTGCTGTG GAAGGGATGA AGGAAGATGT CACTGAAGTG
  241  GTGTTAAACT TCAAGCAATT GGTAGTGAAG ATTTCTGACC TTCTGTTTGA AGATGGTGAA
  301  ATGGTCGAAC CACCACTAGA ACGTTGACCA TTGTTAACGG TAACAGCTGA GAAAGCGGGA
  361  CCGGTGTATG CGAAGGACTT GGAGTGCCCA GCTGGCTTTG AAGTGGTCAA CAAGGACTTG
  421  TACCTGTTCT CGTTGCAAAC TGACAAAAAG GTAACAGTTA ACGTGTATGT GAAACAAGGA
  481  CGGGGGTTTG TTACTTTCTT GGAAAACCGT GAAATGATTA ATTCTTTGGG GATTATTGCC
  541  ACTGACTCGA ACTTCTCCCC GGTATTACAC TGTGGTTATG AAGTACAGGA ATTGAAAACT
  601  TCCAAGCAAA AGATTACTGA TCACTTAACT TTCAAAATTG CTACTAACGG TGCCATATCC
  661  GCTGTGGATG CCTTTGCAAT GGCTGCAAAG ATCTTGATCG AACACCTCAA TCCGATTGTT
  721  AATGTCAACG AATCGATTAA GGCGTTGAAT ATTATCCAAG AGAAAGCCGA AGAACGCCGT
  781  GTCCGTTCGT TTGCGAAGCA AATTGAAGAG TTGGACTTTA CCGTGCGTAC CTTTAACTGT
  841  TTGAAGCGTA GTGGGATCCA CACCTTACAA GAGTTGTTGT CCAAGTCATT AGCTGATATT
  901  CGTGAAATCC GTAACCTCGG TAAGAAATCG GAACGCGAAA TTATTAAGAA GGTACACGAA
  961  TTAGGACTCA AATTAAGATC TTAG
Download Sequence
Operon
OP80
Operon location
230585 - 239373
Protein (mpn191)
Name
DNA-directed RNA polymerase subunit alpha (RNAP subunit alpha) (EC 2.7.7.6) (Transcriptase subunit alpha) 
Stable ID
Mpn191
Molecular Weight
35970
Isoelectric Point
8
Localization
Cytoplasm
Comment two α subunits assemble the enzyme and recognize regulatory factors. Each subunit has two domains: αCTD (C-Terminal domain) binds the UP element of the extended promoter, and αNTD (N-terminal domain) binds the rest of the polymerase
Sequence
MEKFLKYEIKVNNEQARANPNYGIFEVGPLESGFVITIGNAMRRVLLSCIPGASVFALSISGAKQEFAAVEGMKEDVTEV
VLNFKQLVVKISDLLFEDGEMVEPPLERWPLLTVTAEKAGPVYAKDLECPAGFEVVNKDLYLFSLQTDKKVTVNVYVKQG
RGFVTFLENREMINSLGIIATDSNFSPVLHCGYEVQELKTSKQKITDHLTFKIATNGAISAVDAFAMAAKILIEHLNPIV
NVNESIKALNIIQEKAEERRVRSFAKQIEELDFTVRTFNCLKRSGIHTLQELLSKSLADIREIRNLGKKSEREIIKKVHE
LGLKLRS
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mEKFLKYEIK 1 11 M
Oxidation QEFAAVEGmK 65 75 M
Oxidation QEFAAVEGmk 65 75 M
Oxidation QEFAAVEGmKEDVTEVVLNFK 65 86 M
Oxidation ISDLLFEDGEmVEPPLEr 91 109 M
Oxidation ISDLLFEDGEmVEPPLER 91 109 M
Oxidation ISDLLFEDGEmVEPPLERWPLLTVTAEK 91 119 M
Oxidation EmINSLGIIATDSNFSPVLHcGYEVQELk 171 200 M
Oxidation EmINSLGIIATDSNFSPVLHcGYEVQELK 171 200 M
Oxidation emINSLGIIATDSNFSPVLHcGYEVQELk 171 200 M
Formylation emINSLGIIATDSNFSPVLHcGYEVQELk 171 200 N
Oxidation IATNGAISAVDAFAmAAK 213 231 M
GENE/PROTEIN rpoA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
3-243 SSF55257 (IPR009025) DNA-directed RNA polymerase, RBP11-like Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

3.4e-25
22-242 SM00662 (IPR011263) DNA-directed RNA polymerase, RpoA/D/Rpb3-type Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
22-327 TIGR02027 (IPR011773) DNA-directed RNA polymerase, alpha subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'>'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
27-240 PF01193 (IPR011261) DNA-directed RNA polymerase, dimerisation Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046983'>'protein' == '' ? '': 'protein'; 'dimerization' == '' ? '': 'dimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0046983)

5.4e-16
36-51 G3DSA:3.30.1360.10 (n.a.) NULL 0.00000078
52-185 G3DSA:2.170.120.12 (IPR011262) DNA-directed RNA polymerase, insert domain Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046983'>'protein' == '' ? '': 'protein'; 'dimerization' == '' ? '': 'dimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0046983)

2.1e-28
52-186 SSF56553 (IPR011262) DNA-directed RNA polymerase, insert domain Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046983'>'protein' == '' ? '': 'protein'; 'dimerization' == '' ? '': 'dimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0046983)

7.2e-31
65-164 PF01000 (IPR011262) DNA-directed RNA polymerase, insert domain Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046983'>'protein' == '' ? '': 'protein'; 'dimerization' == '' ? '': 'dimerization'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0046983)

0.0000000000067
189-239 G3DSA:3.30.1360.10 (n.a.) NULL 0.00000078
257-320 PF03118 (IPR011260) RNA polymerase, alpha subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

5.1e-19
260-326 SSF47789 (IPR011260) RNA polymerase, alpha subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

1.3e-18
265-326 G3DSA:1.10.150.20 (n.a.) NULL 1.5e-21
268-325 PD001179 (IPR011260) RNA polymerase, alpha subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
9 314 305 - MAG5200 Mycoplasma agalactiae 10 320 1.99993e-41 32.7103 406
21 326 305 - Lactococcus lactis subsp. lactis KF147 17 309 <1e-50 39.6104 523
25 324 299 - MARTH_orf411 Mycoplasma arthritidis 24 326 1.4013e-45 31.7308 439
29 325 296 - Caulobacter crescentus NA1000 33 315 <1e-50 36.7003 466
25 327 302 - MCJ_001550 Mycoplasma conjunctivae 24 330 2.00386e-43 33.9683 424
25 320 295 - MHO_2730 Mycoplasma hominis 24 322 1.00053e-42 29.8701 414
75 326 251 - Bacillus subtilis subsp. subtilis 2 240 2e-39 34.5238 397
10 326 316 - Bacillus subtilis subsp. subtilis 8 311 <1e-50 35.6467 544
29 325 296 - b3295 Escherichia coli 30 314 1e-36 31.7881 371
1 327 326 - MG177 Mycoplasma genitalium 1 328 <1e-50 86.5854 1477
21 326 305 - Rv3457c Mycobacterium tuberculosis 17 309 <1e-50 39.6104 545
1 326 325 - MCAP_0670 Mycoplasma capricolum subsp. capricolum 1 315 <1e-50 41.2844 653
1 322 321 - MS53_0574 Mycoplasma synoviae 1 329 9e-35 29.2899 348
25 319 294 - MHP7448_0168 Mycoplasma hyopneumoniae 7448 24 322 <1e-50 32.899 465
1 325 324 - MMOB2610 Mycoplasma mobile 1 328 <1e-50 36.2018 504
1 326 325 - MSC_0721 Mycoplasma mycoides subsp. mycoides SC 1 315 <1e-50 40.9786 657
19 323 304 - LIC_12846 Leptospira interrogans serovar Copenhage 24 318 1.4013e-45 34.0984 448
1 326 325 - MYPE9920 Mycoplasma penetrans 1 327 <1e-50 48.4756 824
17 325 308 - Mycoplasma pulmonis 16 328 3e-40 34.0557 396
1 327 326 - MYCGA6280 Mycoplasma gallisepticum 1 324 <1e-50 49.3902 834
External IDs
COG
COG0202K
EC number
2.7.7.6
Gene ID
876896
GI
13507930
GO
Transcription
Home COG
K
InterPro
IPR011260|RNA polymerase, alpha subunit, C-terminal
InterPro
IPR011773|DNA-directed RNA polymerase, alpha subunit
InterPro
IPR011262|RNA polymerase, insert
InterPro
IPR011263|RNA polymerase, RpoA/D/Rpb3-type
InterPro
IPR011261|RNA polymerase, dimerisation
InterPro
IPR009025|RNA polymerase, RBP11-like
Old MP number
MP640
Pathway
Division, DNA maintenance
PDB homologs
1i6v_A
PDB homologs
1l9z_A
PDB homologs
1l9u_A
PDB homologs
1COO
Pfam
PF01193
Pfam
PF03118
Pfam
PF01000
PID
g1674345
RefSeq
NP_109879.1
Swiss-Prot protein ID
RPOA_MYCPN
phylomeDB tree
RPOA_MYCPN
UniProt
Q50295
Transcription
IMAGE BROWSERS

OPERON OP80 (Genomic Overview)
Region:230585-239373

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn191STRING legend

PDB image(s)

1i6v

PDB 1i6v

1l9z

PDB 1l9z

1l9u

PDB 1l9u

1COO

PDB 1COO