Gene nusG (MPN067)
Name
nusG
Stable ID
MPN067
Location
83713 - 84675 -
Sequence
    1  ATGGAACAAG TGGAATTAAT CCCGCAATGA TACGTTGCCC CTGTAAGTGT TAAGGATGAA
   61  GCAGTTGTGC GAAACCTCAA AGCTAAGGTA AAAGCTTTGG GATTTGACAA CGAAATCTTA
  121  GATGTAAGGG TTTTGAAAGA ACGCGAAGTC ATCGAAGAAG TCTTTTCCTT AAAATCCGGC
  181  AAGCTGCCCC GTTCATTAAA GAACACCGCT TTTACAAAGT GATTTGTGTT AGATGAAGAC
  241  CGTTATTTAA AGGTGAAGAT TAGCGAGAAG AATTTACTAG GTCGTTACAT CTACATTAAG
  301  ATGATCTACA GTGAAGATGC ATGACGCATT ATCCGTAACT TCCCTGGTAT TACTGGAATT
  361  GTTGGTTCCT CTGGTCGCGG TGCGTTACCA ACTCCTTTAG ACCAAGCCGA TGCTGATAAC
  421  CTCGAACAAA TGCTTAAGGG TATTTCGGTC AATCCGAAAA AGCGGGTGTT AGTGACCAAC
  481  ACTGCCATTG TGGAAATGGA TGCGGACAAG TTTGACGAAA AGTGTCAGTA CATTCTCAAG
  541  CACAAACAAG TTAAACCCGA AGCAATTGCC CAAGTTAACG AATCTGGTGA AATCATTGAT
  601  ACTAACCAGT TTGCGCAAGC TCTAATGGAA GCTAATAAGG CCGAACAAGA CGAATGAAAC
  661  GAGGATGTAG CGATTGTTAA AAGTGAAGCT AACAAGGTTG ACCCATCAGT GTTAATTCCT
  721  TACTTGGGTA AATACGAAAT TGTCGAAGGT GACACTAAGG TCGATCAACT GCAACAATTT
  781  AGTGTTGGTA ACTTAGTGGA AGTCCACTTA ACTGGTGCGA TTCACATTCA AGGTCAAATT
  841  AAGGCTCTAT ACCAAGGAAC AATTAACAAA GCGGTAGTGG AAGTCGAATT AACCACCAAA
  901  ACGCAGTTAA TTAACTTGCC TTTAGAAAAC CTAAGCTTTA TCGAGGTTGA GCAATCGCAC
  961  TAG
Download Sequence
Operon
OP566
Operon location
83150 - 85350
Protein (mpn067)
Name
Transcription antitermination factor
Stable ID
Mpn067
Molecular Weight
35200
Isoelectric Point
5
Localization
Cytoplasm
Comment -
Sequence
MEQVELIPQWYVAPVSVKDEAVVRNLKAKVKALGFDNEILDVRVLKEREVIEEVFSLKSGKLPRSLKNTAFTKWFVLDED
RYLKVKISEKNLLGRYIYIKMIYSEDAWRIIRNFPGITGIVGSSGRGALPTPLDQADADNLEQMLKGISVNPKKRVLVTN
TAIVEMDADKFDEKCQYILKHKQVKPEAIAQVNESGEIIDTNQFAQALMEANKAEQDEWNEDVAIVKSEANKVDPSVLIP
YLGKYEIVEGDTKVDQLQQFSVGNLVEVHLTGAIHIQGQIKALYQGTINKAVVEVELTTKTQLINLPLENLSFIEVEQSH

Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mEQVELIPQWYVAPVSVK 1 19 M
Oxidation mEQVELIPQWYVAPVSVKDEAVVR 1 25 M
Oxidation GALPTPLDQADADNLEQmLK 127 147 M
Oxidation GALPTPLDQADADNLEQmLk 127 147 M
Oxidation VLVTNTAIVEmDADKFDEK 156 175 M
Oxidation VLVTNTAIVEmDADKFDEKcQYILK 156 181 M
GENE/PROTEIN nusG (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
2-147 SSF82679 (IPR006645) Transcription antitermination protein, NusG, N-ter Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0032968'>'positive' == '' ? '': 'positive'; 'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'RNA' == '' ? '': 'RNA'; 'elongation' == '' ? '': 'elongation'; 'from' == '' ? '': 'from'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'II' == '' ? '': 'II'; 'promoter' == '' ? '': 'promoter'; ('GO' == '' ? '': 'GO';:0032968)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003711'>'transcription' == '' ? '': 'transcription'; 'elongation' == '' ? '': 'elongation'; 'regulator' == '' ? '': 'regulator'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003711)

0.00000000000058
7-145 SM00738 (IPR006645) Transcription antitermination protein, NusG, N-ter Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0032968'>'positive' == '' ? '': 'positive'; 'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'RNA' == '' ? '': 'RNA'; 'elongation' == '' ? '': 'elongation'; 'from' == '' ? '': 'from'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'II' == '' ? '': 'II'; 'promoter' == '' ? '': 'promoter'; ('GO' == '' ? '': 'GO';:0032968)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003711'>'transcription' == '' ? '': 'transcription'; 'elongation' == '' ? '': 'elongation'; 'regulator' == '' ? '': 'regulator'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003711)

1.9e-30
9-145 G3DSA:3.30.70.940 (IPR006645) Transcription antitermination protein, NusG, N-ter Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0032968'>'positive' == '' ? '': 'positive'; 'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'RNA' == '' ? '': 'RNA'; 'elongation' == '' ? '': 'elongation'; 'from' == '' ? '': 'from'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'II' == '' ? '': 'II'; 'promoter' == '' ? '': 'promoter'; ('GO' == '' ? '': 'GO';:0032968)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003711'>'transcription' == '' ? '': 'transcription'; 'elongation' == '' ? '': 'elongation'; 'regulator' == '' ? '': 'regulator'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003711)

1.4e-16
9-313 TIGR01956 (IPR010216) Transcription antitermination protein, NusG, mycop Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003711'>'transcription' == '' ? '': 'transcription'; 'elongation' == '' ? '': 'elongation'; 'regulator' == '' ? '': 'regulator'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003711)

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
9 146 137 - MARTH_orf093 Mycoplasma arthritidis 11 125 0.000000000001 28.777 157
84 139 55 - MAG0440 Mycoplasma agalactiae 69 122 0.0000000004 42.8571 135
86 153 67 - MCJ_001790 Mycoplasma conjunctivae 52 129 0.00000000006 43.5897 143
2 141 139 - MCAP_0114 Mycoplasma capricolum subsp. capricolum 12 121 0.000000000000001 33.3333 184
9 283 274 - MYCGA6470 Mycoplasma gallisepticum 8 237 2e-32 30.9353 329
1 317 316 - MG054 Mycoplasma genitalium 1 316 <1e-50 73.125 1250
86 143 57 - MHP7448_0637 Mycoplasma hyopneumoniae 7448 58 115 0.00000001 37.931 123
9 210 201 - MHO_3990 Mycoplasma hominis 9 192 0.0000000000007 25.7282 159
9 135 126 - MMOB1450 Mycoplasma mobile 28 134 0.0000000000003 29.6875 163
79 141 62 - MSC_0962 Mycoplasma mycoides subsp. mycoides SC 47 121 0.00000000000001 45.3333 176
9 170 161 - MYPE8840 Mycoplasma penetrans 19 183 2e-26 38.1818 277
84 207 123 - Lactococcus lactis subsp. lactis KF147 60 170 0.000000006 32 129
96 154 58 - Bacillus subtilis subsp. subtilis 64 119 0.000000002 38.9831 137
96 154 58 - Bacillus subtilis subsp. subtilis 64 119 0.000000002 38.9831 137
86 135 49 - Mycoplasma pulmonis 62 111 0.000000002 40 131
External IDs
COG
COG0250K
Gene ID
876828
GI
13507806
GO
Transcription
Home COG
K
InterPro
IPR001062|Bacterial transcription antitermination protein NusG
InterPro
IPR006645|NGN
InterPro
IPR010216|NusG
Old MP number
MP087
Pathway
Transcription, regulation
Pfam
PF02357
PID
g1673742
RefSeq
NP_109755.1
Swiss-Prot protein ID
Y067_MYCPN
phylomeDB tree
Y067_MYCPN
UniProt
P75049
Transcription
IMAGE BROWSERS

OPERON OP566 (Genomic Overview)
Region:83150-85350

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn067STRING legend