Gene cdd (MPN065)
Name
cdd
Stable ID
MPN065
Location
81690 - 82091 +
Sequence
    1  ATGAAAGTTG ATTTAGATTG AGTCCACCAC AAGTTACAGG AGGTGGTCAA TCATGCCTAC
   61  ACGCCTTTTT CAAAGTTTAA GGTAGCTTGT ATGTTGGTGG CCAATAACCA GGCATTTTAT
  121  GGAGTCAATA TTGAAAACGC TTCTTACCCA GTAACCCTGT GTGCGGAACG TAGTGCGATT
  181  GCTAACATGG TCACTAGTAT CGGCAAGGCC ACAATTGATT ATGTCTTTGT GTACTTTGAC
  241  ACTAAAACTC CAACCAATTC ACCTTGTGGC ATGTGTCGGC AAAACATCTT TGAGTTTGCC
  301  ACTGATAAGA CCCAGTTATT CTGCATTGAG AAGGACAAGA GCTTTAAACA ATTTACTATT
  361  CCCGAAATTT TAAAGGGAGG TTTTCGATCA TATGAACAGT AA
Download Sequence
Operon
OP25
Operon location
79008 - 83850
Protein (mpn065)
Name
Cytidine deaminase (CDA) (EC 3.5.4.5) (Cytidine aminohydrolase)
Stable ID
Mpn065
Molecular Weight
14630
Isoelectric Point
8
Localization
Cytoplasm
Comment -
Sequence
MKVDLDWVHHKLQEVVNHAYTPFSKFKVACMLVANNQAFYGVNIENASYPVTLCAERSAIANMVTSIGKATIDYVFVYFD
TKTPTNSPCGMCRQNIFEFATDKTQLFCIEKDKSFKQFTIPEILKGGFRSYEQ
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation SAIANmVTSIGK 58 70 M
Oxidation SAIANmVTSIGk 58 70 M
GENE/PROTEIN cdd (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-129 SSF53927 (IPR016193) Cytidine deaminase-like Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

1.8e-31
6-130 G3DSA:3.40.140.10 (n.a.) NULL 8.6e-36
6-133 TIGR01354 (IPR006262) Cytidine deaminase, homotetrameric Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046087'>'cytidine' == '' ? '': 'cytidine'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0046087)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004126'>'cytidine' == '' ? '': 'cytidine'; 'deaminase' == '' ? '': 'deaminase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004126)

0
7-104 PF00383 (IPR002125) CMP/dCMP deaminase, zinc-binding Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008270'>'zinc' == '' ? '': 'zinc'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0008270) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016787'>'hydrolase' == '' ? '': 'hydrolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016787)

1.5e-16
11-124 PTHR11644:SF2 (IPR006262) Cytidine deaminase, homotetrameric Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046087'>'cytidine' == '' ? '': 'cytidine'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0046087)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004126'>'cytidine' == '' ? '': 'cytidine'; 'deaminase' == '' ? '': 'deaminase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004126)

2.5e-27
11-124 PTHR11644 (n.a.) NULL 2.5e-27
54-96 PS00903 (IPR016192) APOBEC/CMP deaminase, zinc-binding Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008270'>'zinc' == '' ? '': 'zinc'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0008270) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016787'>'hydrolase' == '' ? '': 'hydrolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016787)

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
11 118 107 - MARTH_orf331 Mycoplasma arthritidis 6 114 0.0000000009 30.9091 128
11 107 96 - MAG1160 Mycoplasma agalactiae 4 101 0.0000000000003 34.6939 158
11 128 117 - MCJ_002770 Mycoplasma conjunctivae 6 124 0.00000000000002 33.3333 167
5 128 123 - MYCGA5830 Mycoplasma gallisepticum 8 135 5e-24 40.625 251
1 129 128 - MG052 Mycoplasma genitalium 1 128 <1e-50 67.4419 488
5 128 123 - MHP7448_0157 Mycoplasma hyopneumoniae 7448 1 126 3e-16 33.3333 184
11 124 113 - MHO_2580 Mycoplasma hominis 5 120 0.0000000001 29.9145 134
11 104 93 - MMOB3470 Mycoplasma mobile 11 108 0.0000000000002 38.3838 159
2 128 126 - MYPE1060 Mycoplasma penetrans 3 128 1e-25 42.1875 266
20 132 112 - Lactococcus lactis subsp. lactis KF147 19 130 0.00000000000001 35.9649 174
10 129 119 - MS53_0388 Mycoplasma synoviae 9 129 8e-19 37.1901 206
4 103 99 - MT3416 Mycobacterium tuberculosis 3 103 0.0000000001 32.0388 141
6 128 122 - Caulobacter crescentus NA1000 39 161 3e-18 34.6774 206
17 130 113 - Bacillus subtilis subsp. subtilis 15 127 4e-16 38.2609 189
17 130 113 - Bacillus subtilis subsp. subtilis 15 127 4e-16 38.2609 189
5 112 107 - Mycoplasma pulmonis 1 109 4e-16 31.8182 183
External IDs
COG
COG0295F
EC number
3.5.4.5
Gene ID
877155
GI
13507804
GO
Nucleotide transport and metabolism
Home COG
F
InterPro
IPR002125|CMP/dCMP deaminase, zinc-binding
InterPro
IPR006262|Cytidine deaminase, homotetrameric
Old MP number
MP089
Pathway
Metabolism, nucleotides
PDB homologs
1jtk_A
PDB homologs
1mq0_A
PDB homologs
1ux0_A
PDB homologs
1AF2-A
Pfam
PF00383
PID
g1673744
RefSeq
NP_109753.1
Swiss-Prot protein ID
CDD_MYCPN
phylomeDB tree
CDD_MYCPN
UniProt
P75051
Transcription
IMAGE BROWSERS

OPERON OP25 (Genomic Overview)
Region:79008-83850

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn065STRING legend

PDB image(s)

1jtk

PDB 1jtk

1mq0

PDB 1mq0

1ux0

PDB 1ux0

1AF2

PDB 1AF2