Gene deoC (MPN063)
Name
deoC
Stable ID
MPN063
Location
79753 - 80427 +
Sequence
    1  ATGAAATTAG AATACAACCG CATTATTGAC AGTACACTAC TTAAAGCTGA TACCTTACCC
   61  CACGAAATTG ATGCTTTATG TGCTGATGCT CATAAGTACC AGTTTTACGC AGTTTGTGTC
  121  AATCCTAGCT ATGTGCGGTA TGCCAAAAAT ATCCTTAAGG GTACGGGGGT GAAACTGTGC
  181  ACTGTCGTTG GTTTTCCCTT AGGACAAACA ACACAACGCC AGAAGGTGTA TGAAACTAAG
  241  ATTGCCATTA AGGAAGGTGC GGATGAAATT GACATGGTAA TGAACATTGC CGAGTTCAAA
  301  AAGCGCTGTG CCTGTGTCAT TAGTGAAATA AGGGCAGTCA AAAAGGTTTG TGGTAAGCGA
  361  ACGCTCAAAG TCATTATTGA AACGGCTTTG TTAAACCAGG ACGAAATTCG TGATGCCGTT
  421  AATGTCTGTA TTGATGGTAA CGCTGACTTT GTCAAAACTT CTACCGGGTT TTCCATGCGT
  481  GGTGCATCAT TGGAAGATAT CACAATTATG CGCGAAGCTA GTGGTAATCT CATTAAGATC
  541  AAAGCATCGG GTGGGGTTCA AACAGCGCAG CAATTCCTTG ACTTCTTTAA TGCTGGAGTT
  601  AGTCGGATTG GCACTTCCAA TGCGGTCAAG ATTATGGAAG AATTGCACAA ACTAGAAAGC
  661  CATGAACATC GTTAA
Download Sequence
Operon
OP25
Operon location
79008 - 83850
Protein (mpn063)
Name
Deoxyribose-phosphate aldolase (EC 4.1.2.4) (Phosphodeoxyriboaldolase) (Deoxyriboaldolase) (DERA)
Stable ID
Mpn063
Molecular Weight
24640
Isoelectric Point
8
Localization
Cytoplasm
Comment deoxyribose-phosphate aldolase (deoC); 2-deoxy-D-ribose 5-phosphate = D-glyceraldehyde 3-phosphate + acetaldehyde;
Sequence
MKLEYNRIIDSTLLKADTLPHEIDALCADAHKYQFYAVCVNPSYVRYAKNILKGTGVKLCTVVGFPLGQTTQRQKVYETK
IAIKEGADEIDMVMNIAEFKKRCACVISEIRAVKKVCGKRTLKVIIETALLNQDEIRDAVNVCIDGNADFVKTSTGFSMR
GASLEDITIMREASGNLIKIKASGGVQTAQQFLDFFNAGVSRIGTSNAVKIMEELHKLESHEHR
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mKLEYNR 1 8 M
Oxidation mKLEYNRIIDSTLLK 1 16 M
Oxidation IAIKEGADEIDMVmNIAEFK 81 101 M
Oxidation IAIKEGADEIDmVmNIAEFK 81 101 M
Oxidation IAIKEGADEIDmVMNIAEFK 81 101 M
Oxidation IAIKEGADEIDmVMNIAEFKK 81 102 M
Oxidation IAIKEGADEIDMVmNIAEFKK 81 102 M
Oxidation IAIKEGADEIDmVmNIAEFKKR 81 103 M
Oxidation EGADEIDmVmNIAEFK 85 101 M
Oxidation EGADEIDmVMNIAEFK 85 101 M
Oxidation EGADEIDMVmNIAEFK 85 101 M
Oxidation TSTGFSmR 153 161 M
Oxidation TSTGFSmRGASLEDITIMR 153 172 M
Oxidation GASLEDITImR 161 172 M
Oxidation GASLEDITImr 161 172 M
Oxidation GASLEDITImREASGNLIK 161 180 M
Oxidation GASLEDITImREASGNLIKIK 161 182 M
Oxidation IGTSNAVKImEELHKLESHEHR 203 225 M
Oxidation ImEELHk 211 218 M
Oxidation ImEELHK 211 218 M
Oxidation ImEELHKLESHEHR 211 225 M
GENE/PROTEIN deoC (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-223 PIRSF001357 (IPR011343) Deoxyribose-phosphate aldolase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009264'>'deoxyribonucleotide' == '' ? '': 'deoxyribonucleotide'; 'catabolic' == '' ? '': 'catabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0009264)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005737'>'cytoplasm' == '' ? '': 'cytoplasm'; ('GO' == '' ? '': 'GO';:0005737)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004139'>'deoxyribose' == '' ? '': 'deoxyribose';-'phosphate' == '' ? '': 'phosphate'; 'aldolase' == '' ? '': 'aldolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004139)

0
3-217 SSF51569 (n.a.) NULL 0
4-213 TIGR00126 (IPR011343) Deoxyribose-phosphate aldolase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009264'>'deoxyribonucleotide' == '' ? '': 'deoxyribonucleotide'; 'catabolic' == '' ? '': 'catabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0009264)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005737'>'cytoplasm' == '' ? '': 'cytoplasm'; ('GO' == '' ? '': 'GO';:0005737)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004139'>'deoxyribose' == '' ? '': 'deoxyribose';-'phosphate' == '' ? '': 'phosphate'; 'aldolase' == '' ? '': 'aldolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004139)

0
5-213 PF01791 (IPR002915) Deoxyribose-phosphate aldolase/phospho-2-dehydro-3 Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016829'>'lyase' == '' ? '': 'lyase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016829)

0
5-217 G3DSA:3.20.20.70 (IPR013785) Aldolase-type TIM barrel Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008152'>'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0008152)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

0
8-218 PTHR10889 (IPR011343) Deoxyribose-phosphate aldolase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009264'>'deoxyribonucleotide' == '' ? '': 'deoxyribonucleotide'; 'catabolic' == '' ? '': 'catabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0009264)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005737'>'cytoplasm' == '' ? '': 'cytoplasm'; ('GO' == '' ? '': 'GO';:0005737)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004139'>'deoxyribose' == '' ? '': 'deoxyribose';-'phosphate' == '' ? '': 'phosphate'; 'aldolase' == '' ? '': 'aldolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004139)

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
7 191 184 - b4381 Escherichia coli 13 211 0.000000000000003 32.6829 183
3 217 214 - MARTH_orf239 Mycoplasma arthritidis 1 216 <1e-50 47.2222 540
1 213 212 - MAG5130 Mycoplasma agalactiae 1 214 <1e-50 47.1963 496
13 212 199 - MCJ_005570 Mycoplasma conjunctivae 1 201 <1e-50 43.7811 462
1 212 211 - MCAP_0755 Mycoplasma capricolum subsp. capricolum 1 213 5.60519e-45 42.723 435
3 219 216 - MYCGA5850 Mycoplasma gallisepticum 7 223 <1e-50 60.3687 688
106 163 57 - MYCGA2500 Mycoplasma gallisepticum 11 68 0.0000000000001 53.4483 165
1 223 222 - MG050 Mycoplasma genitalium 1 223 <1e-50 82.9596 1001
3 215 212 - MHP7448_0527 Mycoplasma hyopneumoniae 7448 1 214 <1e-50 46.729 485
4 219 215 - MHO_3330 Mycoplasma hominis 3 219 <1e-50 49.7696 540
3 217 214 - MMOB5370 Mycoplasma mobile 1 216 <1e-50 48.1481 537
1 172 171 - MSC_0828 Mycoplasma mycoides subsp. mycoides SC 1 173 2e-34 42.1965 345
7 215 208 - MYPE1170 Mycoplasma penetrans 10 219 <1e-50 45.2381 467
3 215 212 - Lactococcus lactis subsp. lactis KF147 1 214 <1e-50 47.1963 478
3 213 210 - MS53_0445 Mycoplasma synoviae 1 215 1.4013e-45 40 440
2 215 213 - Rv0478 Mycobacterium tuberculosis 7 223 5e-24 37.2727 259
3 213 210 - Bacillus subtilis subsp. subtilis 1 213 <1e-50 47.8873 460
3 213 210 - Bacillus subtilis subsp. subtilis 1 213 <1e-50 47.4178 459
3 213 210 - Mycoplasma pulmonis 1 212 <1e-50 48.5849 511
External IDs
COG
COG0274F
EC number
4.1.2.4
Gene ID
876837
GI
13507802
GO
Nucleotide transport and metabolism
Home COG
F
InterPro
IPR002915|Deoxyribose-phosphate aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase
InterPro
IPR011343|Deoxyribose-phosphate aldolase
Old MP number
MP091
Pathway
Metabolism energy, Sugars
PDB homologs
1o0y_A
PDB homologs
1mzh_A
PDB homologs
1j2w_A
Pfam
PF01791
PID
g1673746
RefSeq
NP_109751.1
Swiss-Prot protein ID
DEOC_MYCPN
phylomeDB tree
DEOC_MYCPN
UniProt
P09924
Transcription
IMAGE BROWSERS

OPERON OP25 (Genomic Overview)
Region:79008-83850

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn063STRING legend

PDB image(s)

1o0y

PDB 1o0y

1mzh

PDB 1mzh

1j2w

PDB 1j2w