Gene deoD (MPN062)
Name
deoD
Stable ID
MPN062
Location
79033 - 79749 +
Sequence
    1  ATGACACCGC ACATAAACGC AAAAAAAGAT GACATTGCTA AGGTTGTTTT AATGCCCGGT
   61  GATCCCTTAC GTGCTAAGTG GATTGCGGAA CAATTTATGG AAAAGCCCCG GCTCGTCAAC
  121  GAAGTGCGAG GCATGTTAGC TTTTACCGGT CAGTATAAGG GTAAAACCAT TACCATTATG
  181  GGCCATGGCA TGGGGATTCC CTCAATTGGG ATTTATTCTT ATGAACTGAT GAAGTTCTAT
  241  GAGGTTAATA CCATTATCCG AATTGGTAGT TGCGGGGCGT TGCAAGGTTC CTTAAACCTC
  301  CAGGACCTCA TTATTGCCGC TAAGGCTTGG AGTGAGTCGA TTTACGCTAA CGACATGGGT
  361  GTGGAAGTGC CAGCAGACAA GATCTTAATG GCCTCCCCGC AACTAGTAGA GTTAGCTAAA
  421  AAGACCGCTA ACCAACTTCA ACTGGCCTTC CATGAGGGCT TGGTGTTCTG TGAGGATGCC
  481  TTCCACCAAA TCAGGAAAGA CGTGTTAAAG CTAGCACAAG AAAAACACGC TTTAGCAGTG
  541  GAAATGGAAG CGCATGCTCT GTACGCTAAT GCCATGCTGC TCAACAAGCA AGCGTTAACG
  601  ATGCTCACGG TGTCCGATTC TTTGGTAACC CATGCTGCTC TACCAGCGGA ACAACGCCAA
  661  GCCACCTTTA AGAACATGGC TATCTTATCC TTGGAAATGG CTAGCCAACT CGTTTAA
Download Sequence
Operon
OP25
Operon location
79008 - 83850
Protein (mpn062)
Name
Purine nucleoside phosphorylase deoD-type (PNP) (EC 2.4.2.1)
Stable ID
Mpn062
Molecular Weight
26180
Isoelectric Point
7
Localization
Cytoplasm
Comment purine-nucleoside phosphorylase; Salvage of nucleosides and nucleotides; purine-nucleoside phosphorylase; Purine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphate; in addition it can transfer ribose from one base to another ba
Sequence
MTPHINAKKDDIAKVVLMPGDPLRAKWIAEQFMEKPRLVNEVRGMLAFTGQYKGKTITIMGHGMGIPSIGIYSYELMKFY
EVNTIIRIGSCGALQGSLNLQDLIIAAKAWSESIYANDMGVEVPADKILMASPQLVELAKKTANQLQLAFHEGLVFCEDA
FHQIRKDVLKLAQEKHALAVEMEAHALYANAMLLNKQALTMLTVSDSLVTHAALPAEQRQATFKNMAILSLEMASQLV
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mTPHINAK 1 9 M
Oxidation mTPHINAKKDDIAK 1 15 M
Oxidation KDDIAKVVLmPGDPLR 9 25 M
Oxidation KDDIAKVVLmPGDPLRAK 9 27 M
Oxidation VVLmPGDPLr 15 25 M
Oxidation VVLmPGDPLR 15 25 M
Oxidation VVLmPGDPLRAK 15 27 M
Oxidation AKWIAEQFmEKPR 25 38 M
Oxidation WIAEQFmEKPR 27 38 M
Oxidation WIAEQFmEkPr 27 38 M
Oxidation GmLAFTGQYk 44 54 M
Oxidation GmLAFTGQYK 44 54 M
Oxidation AWSESIYANDmGVEVPADK 109 128 M
Oxidation AWSESIYANDmGVEVPADk 109 128 M
Oxidation AWSESIYANDmGVEVPADKILmASPQLVELAK 109 141 M
Oxidation ILmASPQLVELAK 128 141 M
Oxidation ILmASPQLVELAk 128 141 M
Oxidation ILmASPQLVELAKK 128 142 M
Oxidation HALAVEMEAHALYANAmLLNK 176 197 M
Oxidation HALAVEmEAHALYANAmLLNK 176 197 M
Oxidation HALAVEmEAHALYANAMLLNK 176 197 M
Oxidation QALTmLTVSDSLVTHAALPAEQR 197 220 M
Oxidation QATFKNmAILSLEmASQLV 220 239 M
Oxidation NmAILSLEMASQLV 225 239 M
Oxidation NMAILSLEmASQLV 225 239 M
Oxidation NmAILSLEmASQLV 225 239 M
GENE/PROTEIN deoD (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-236 SSF53167 (n.a.) NULL 0
1-238 PTHR21234 (IPR018017) Nucleoside phosphorylase 0
1-238 PTHR21234:SF7 (n.a.) NULL 0
4-237 TIGR00107 (IPR004402) Purine nucleoside phosphorylase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'>'nucleobase' == '' ? '': 'nucleobase';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004731'>'purine' == '' ? '': 'purine';-'nucleoside' == '' ? '': 'nucleoside'; 'phosphorylase' == '' ? '': 'phosphorylase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004731)

0
8-235 G3DSA:3.40.50.1580 (n.a.) NULL 0
14-218 PF01048 (IPR000845) Nucleoside phosphorylase domain Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009116'>'nucleoside' == '' ? '': 'nucleoside'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0009116)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

3.4e-33
61-76 PS01232 (IPR018016) Nucleoside phosphorylase, conserved site Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'transferase' == '' ? '': 'transferase';'>'transferase' == '' ? '': 'transferase'; 'activity' == '' ? '': 'activity';

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
2 232 230 - b4384 Escherichia coli 3 231 <1e-50 44.5887 486
4 168 164 - b3831 Escherichia coli 8 171 0.00000000003 29.4118 149
1 237 236 - MARTH_orf237 Mycoplasma arthritidis 1 237 <1e-50 42.0833 497
1 234 233 - MAG5110 Mycoplasma agalactiae 1 233 <1e-50 48.1013 518
2 226 224 - MAG4180 Mycoplasma agalactiae 3 225 7e-36 33.913 356
1 233 232 - MCJ_005600 Mycoplasma conjunctivae 1 231 <1e-50 45.7983 508
4 224 220 - MCAP_0849 Mycoplasma capricolum subsp. capricolum 2 205 4e-33 38.326 333
51 206 155 - MCAP_0528 Mycoplasma capricolum subsp. capricolum 27 176 0.0000007 28.75 107
1 237 236 - MYCGA5860 Mycoplasma gallisepticum 1 236 <1e-50 58.2278 728
1 238 237 - MG049 Mycoplasma genitalium 1 238 <1e-50 75.6302 945
1 232 231 - MHP7448_0084 Mycoplasma hyopneumoniae 7448 1 230 <1e-50 44.0171 457
1 237 236 - MHO_3350 Mycoplasma hominis 1 237 <1e-50 44.7257 536
1 234 233 - MMOB5350 Mycoplasma mobile 1 233 <1e-50 47.9167 544
4 224 220 - MSC_0835 Mycoplasma mycoides subsp. mycoides SC 2 205 3e-33 38.326 335
51 206 155 - MSC_0443 Mycoplasma mycoides subsp. mycoides SC 34 183 0.0000001 29.375 114
1 237 236 - MYPE1040 Mycoplasma penetrans 10 245 <1e-50 50.6329 651
2 232 230 - Lactococcus lactis subsp. lactis KF147 3 229 2.00386e-43 40.7725 426
1 233 232 - MS53_0447 Mycoplasma synoviae 1 231 <1e-50 47.6395 523
4 203 199 - Lactococcus lactis subsp. lactis KF147 7 198 0.000000000007 29.3532 153
1 236 235 - Bacillus subtilis subsp. subtilis 1 233 1.4013e-45 42.3729 448
1 236 235 - Bacillus subtilis subsp. subtilis 1 233 1.4013e-45 42.3729 447
1 233 232 - Mycoplasma pulmonis 1 231 <1e-50 44.2553 491
External IDs
COG
COG0813F
EC number
2.4.2.1
Gene ID
876955
GI
13507801
GO
Nucleotide transport and metabolism
Home COG
F
InterPro
IPR000845|Purine and other phosphorylases, family 1
InterPro
IPR004402|Purine nucleoside phosphorylase
Old MP number
MP092
Pathway
Metabolism, nucleotides
PDB homologs
1ecp_A
PDB homologs
1a69_A
PDB homologs
1k9s_A
PDB homologs
1A69-A
Pfam
PF01048
PID
g1673747
RefSeq
NP_109750.1
Swiss-Prot protein ID
DEOD_MYCPN
phylomeDB tree
DEOD_MYCPN
UniProt
P75053
Transcription
IMAGE BROWSERS

OPERON OP25 (Genomic Overview)
Region:79008-83850

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn062STRING legend

PDB image(s)

1ecp

PDB 1ecp

1a69

PDB 1a69

1k9s

PDB 1k9s

1A69

PDB 1A69