Gene ptsH (MPN053)
Name
ptsH
Stable ID
MPN053
Location
66822 - 67088 +
Sequence
    1  ATGAAGAAGA TTCAAGTAGT CGTTAAAGAC CCTGTGGGCA TTCACGCCCG TCCTGCTAGT
   61  ATTATTGCTG GTGAGGCTAA TAAATTTAAA TCGGAATTAA AGCTAGTATC ACCAAGCGGC
  121  GTTGAAGGTA ACATCAAGTC GATCATCAAC TTAATGTCTT TAGGCATTAA GCAAAACGAC
  181  CACATTACCA TCAAGGCAGA AGGAACTGAT GAAGAAGAGG CACTAAATGC TATTAAAGCA
  241  GTTTTAGAAA AACACCAAGT TATTTAA
Download Sequence
Operon
OP20
Operon location
64803 - 67250
Protein (mpn053)
Name
Phosphocarrier protein HPr (EC 2.7.11.-) (Histidine-containing protein)
Stable ID
Mpn053
Molecular Weight
9680
Isoelectric Point
9
Localization
Cytoplasm
Comment Also hpr
Sequence
MKKIQVVVKDPVGIHARPASIIAGEANKFKSELKLVSPSGVEGNIKSIINLMSLGIKQNDHITIKAEGTDEEEALNAIKA
VLEKHQVI
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation LVSPSGVEGNIKsIINLmSLGIK 35 58 M
Oxidation LVSPSGVEGNIKSIINLmSLGIK 35 58 M
Phosphorylation LVSPSGVEGNIKsIINLmSLGIK 35 58 S
Phosphorylation LVSPSGVEGNIKsIINLMSLGIK 35 58 S
Oxidation SIINLmSLGIk 47 58 M
Oxidation SIINLmSLGIK 47 58 M
Phosphorylation sIINLMSLGIK 47 58 S
Oxidation SIINLmSLGIKQNDHITIK 47 66 M
GENE/PROTEIN ptsH (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-83 TIGR01003 (IPR005698) Phosphotransferase system, phosphocarrier HPr prot Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

3.30001e-32
1-84 G3DSA:3.30.1340.10 (IPR000032) Phosphotransferase system, phosphocarrier HPr prot Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

2.6e-26
1-84 PF00381 (IPR005698) Phosphotransferase system, phosphocarrier HPr prot Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

5.1e-25
1-86 SSF55594 (IPR000032) Phosphotransferase system, phosphocarrier HPr prot Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

3.80001e-23
1-88 PS51350 (IPR000032) Phosphotransferase system, phosphocarrier HPr prot Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

0
13-20 PS00369 (IPR001020) Phosphotransferase system, HPr histidine phosphory Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006810'>'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0006810) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

0
13-29 PR00107 (IPR005698) Phosphotransferase system, phosphocarrier HPr prot Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

5.49999e-19
39-54 PR00107 (IPR005698) Phosphotransferase system, phosphocarrier HPr prot Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

5.49999e-19
40-55 PS00589 (IPR002114) Phosphotransferase system, HPr serine phosphorylat Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

0
54-71 PR00107 (IPR005698) Phosphotransferase system, phosphocarrier HPr prot Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0009401'>'phosphoenolpyruvate' == '' ? '': 'phosphoenolpyruvate';-'dependent' == '' ? '': 'dependent'; 'sugar' == '' ? '': 'sugar'; 'phosphotransferase' == '' ? '': 'phosphotransferase'; 'system' == '' ? '': 'system'; ('GO' == '' ? '': 'GO';:0009401)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005351'>'sugar' == '' ? '': 'sugar';:'hydrogen' == '' ? '': 'hydrogen'; 'symporter' == '' ? '': 'symporter'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0005351)

5.49999e-19
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
1 88 87 - MAG4690 Mycoplasma agalactiae 1 89 3e-19 46.0674 207
5 83 78 - Caulobacter crescentus NA1000 173 250 0.000000006 39.2405 124
5 83 78 - Caulobacter crescentus NA1000 199 276 0.000000005 39.2405 124
1 88 87 - MCJ_001940 Mycoplasma conjunctivae 1 91 0.0000000004 32.967 128
12 84 72 - Lactococcus lactis subsp. lactis KF147 12 83 0.000000000002 43.8356 152
8 85 77 - Bacillus subtilis subsp. subtilis 3 79 0.0000000001 37.1795 141
13 82 69 - Bacillus subtilis subsp. subtilis 13 81 0.00000000002 44.2857 148
1 85 84 - Bacillus subtilis subsp. subtilis 1 84 0.00000000005 36.4706 144
3 82 79 - b3206 Escherichia coli 4 83 0.000001 33.75 105
1 75 74 - b2415 Escherichia coli 1 74 0.0000000003 38.6667 135
1 82 81 - MCAP_0716 Mycoplasma capricolum subsp. capricolum 1 81 1e-17 43.9024 193
1 88 87 - MG041 Mycoplasma genitalium 1 88 7e-38 81.8182 366
5 78 73 - b2169 Escherichia coli 289 364 0.00000005 30.2632 116
1 85 84 - b2383 Escherichia coli 1 82 0.000005 30.2326 99
8 88 80 - MS53_0394 Mycoplasma synoviae 8 87 2e-19 45.679 207
1 88 87 - MHP7448_0609 Mycoplasma hyopneumoniae 7448 1 87 0.00000000000002 44.3182 164
1 82 81 - MMOB4060 Mycoplasma mobile 1 82 2e-17 47.561 191
1 82 81 - MSC_0768 Mycoplasma mycoides subsp. mycoides SC 1 81 6e-18 45.122 196
14 87 73 - LIC_11547 Leptospira interrogans serovar Copenhage 1 73 0.0000001 37.8378 112
1 88 87 - MYCGA0290 Mycoplasma gallisepticum 1 88 0.000000000000009 37.5 169
1 88 87 - MYPE2800 Mycoplasma penetrans 1 87 2e-17 46.5909 192
1 88 87 - Mycoplasma pulmonis 1 87 1e-19 45.4545 211
External IDs
COG
COG1925G
EC number
2.7.11.-
Gene ID
876864
GI
13507792
GO
Carbohydrate transport and metabolism  
Home COG
G
InterPro
IPR001020|Phosphotransferase system, HPr histidine phosphorylation site
InterPro
IPR002114|Phosphotransferase system, HPr serine phosphorylation site
InterPro
IPR005698|Phosphotransferase system, HPr
InterPro
IPR000032|Phosphotransferase system, phosphocarrier HPr protein
Old MP number
MP101
Pathway
Regulation
Pathway
transporter, general PTS system component
PDB homologs
1ka5_A
PDB homologs
1kkl_H
PDB homologs
1qr5_A
PDB homologs
1PCH
Pfam
MPN053
PID
g1673757
RefSeq
NP_109741.1
Swiss-Prot protein ID
PTHP_MYCPN
phylomeDB tree
PTHP_MYCPN
UniProt
P75061
Transcription
IMAGE BROWSERS

OPERON OP20 (Genomic Overview)
Region:64803-67250

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn053STRING legend

PDB image(s)

1ka5

PDB 1ka5

1kkl

PDB 1kkl

1qr5

PDB 1qr5

1PCH

PDB 1PCH