Gene glpD (MPN051)
Name
glpD
Stable ID
MPN051
Location
63494 - 64648 -
Sequence
    1  ATGGAAACAA GAGATGTTTT AATAGTTGGC GGTGGTGTAA TAGGCTGTGC CACTGCTTAT
   61  GAATTGAGCC AGTACAAGCT CAAAGTGACA CTGGTAGAAA AGCACCATTA TTTGGCACAA
  121  GAGACTAGCC ATGCCAACAG TGGTGTTATC CACACTGGCA TTGATCCCAA TCCACACAAG
  181  TTAACTGCTA AATACAACAT TTTGGGTAAA AAGCTCTGAT TAAATACCTA CTTTAAACGC
  241  TTAGGTTTTC CAAGGCAAAA GATCCGTACT TTAATTGTGG CTTTCAATGA AATGGAGCGC
  301  GAACAATTAG AAGTACTAAA GCAAAGAGGC ATTGCCAATC AAATTAATCT GGAAGATATT
  361  CAAATGCTCT CTAAAGAAGA AACCTTAAAG TTAGAGCCTT ACGTTAATCC GGAAATTGTG
  421  GCTGGATTAA AAATCGAAGG TAGCTGAGCA ATTGATCCAG TGTTAGCGAG CAAATGTTTA
  481  GCTTTAGCAG CACAGCAAAA CAAAGTACAA ATTTGCACTA ATACTGAGGT TACTAATATT
  541  AGTAAGCAAG TTGATGGGAC TTATTTAGTT TGAACTAACA ACGAAACTAC TCCTAGTTTT
  601  AAAGTTAAGA AGATTATTGA TGCTGCAGGT CATTATGCTG ATTATTTAGC TCATTTAGCC
  661  AAAGCTGATG ATTTTGAACA AACAACCCGT CGAGGTCAGT ATGTGGTGGT AACTAATCAG
  721  GGCGAACTCC ACTTAAACTC AATGGTTTTC ATGGTACCAA CAATCCATGG TAAAGGGGTA
  781  ATTGTGTCAC CCATGTTAGA TGGCAACTTC TTAGTCGGAC CCACCGCTTT AGATGGGGTA
  841  GACAAGGAAG CTACTCGTTA CATTACCAAA GATGCTCCAT GTATGTTGAC TAAGATTGGC
  901  AAACATATGG TGCCAAGTCT AAACATTAAT AATGCCTTAA TAAGCTTTGC TGGTTCGCGT
  961  CCAATTGACA AAGCCACTAA TGACTTTATT ATTAGAGTAG CTCACAATGA CCCTGACTTT
 1021  GTCATTTTAG GGGGTATGAA ATCCCCAGGG CTAACTGCAG CACCAGCCAT TGTCCGGGAA
 1081  GCTGTCAGAC TTTTAAATTG GAAATTAACT AAAAAGCCGA ACTGAAACGG AAAGTACAAT
 1141  CTGCCATGGA TCTAA
Download Sequence
Operon
OP580
Operon location
61000 - 64655
Protein (mpn051)
Name
Glycerol-3-phospate dehydrogenase  (EC 1.1.99.5)
Stable ID
Mpn051
Molecular Weight
42240
Isoelectric Point
9
Localization
Cytoplasm
Comment Also glycerol-3-phosphate oxidase (EC 1.1.3.21). In M. mycoides secretes H2O2 and it is located at the surface (Vet. Res. 2009, 40:35)
Sequence
METRDVLIVGGGVIGCATAYELSQYKLKVTLVEKHHYLAQETSHANSGVIHTGIDPNPHKLTAKYNILGKKLWLNTYFKR
LGFPRQKIRTLIVAFNEMEREQLEVLKQRGIANQINLEDIQMLSKEETLKLEPYVNPEIVAGLKIEGSWAIDPVLASKCL
ALAAQQNKVQICTNTEVTNISKQVDGTYLVWTNNETTPSFKVKKIIDAAGHYADYLAHLAKADDFEQTTRRGQYVVVTNQ
GELHLNSMVFMVPTIHGKGVIVSPMLDGNFLVGPTALDGVDKEATRYITKDAPCMLTKIGKHMVPSLNINNALISFAGSR
PIDKATNDFIIRVAHNDPDFVILGGMKSPGLTAAPAIVREAVRLLNWKLTKKPNWNGKYNLPWI
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Methylation VTLVEk 29 35 K
Oxidation IRTLIVAFNEmER 88 101 M
Oxidation TLIVAFNEmER 90 101 M
Oxidation TLIVAFNEmEREQLEVLK 90 108 M
Oxidation TLIVAFNEmEREQLEVLKQR 90 110 M
Oxidation GIANQINLEDIQmLSk 110 126 M
Oxidation GIANQINLEDIQmLSK 110 126 M
Oxidation GIANQINLEDIQmLSKEETLKLEPYVNPEIVAGLK 110 145 M
Oxidation RGQYVVVTNQGELHLNSmVFMVPTIHGK 231 259 M
Oxidation RGQYVVVTNQGELHLNSMVFmVPTIHGK 231 259 M
Oxidation RGQYVVVTNQGELHLNSmVFmVPTIHGK 231 259 M
Oxidation GQYVVVTNQGELHLNSmVFMVPTIHGK 232 259 M
Oxidation GVIVSPmLDGNFLVGPTALDGVDK 259 283 M
Oxidation GVIVSPmLDGNFLVGPTALDGVDKEATR 259 287 M
Oxidation YITKDAPcmLTK 287 299 M
Oxidation DAPcmLTK 291 299 M
Oxidation IGKHmVPSLNINNALISFAGSRPIDK 299 325 M
Oxidation IGKHmVPSLNINNALISFAGSRPIDKATNDFIIR 299 333 M
Oxidation HmVPSLNINNALISFAGSRPIDK 302 325 M
Oxidation HmVPSLNINNALISFAGSRPIDKATNDFIIR 302 333 M
Oxidation VAHNDPDFVILGGmK 333 348 M
GENE/PROTEIN glpD (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-16 PS51257 (n.a.) NULL 0
1-365 PTHR13847 (n.a.) NULL 0
1-365 PTHR13847:SF21 (n.a.) NULL 0
3-82 G3DSA:3.50.50.60 (n.a.) NULL 1.7e-34
3-365 SSF51905 (n.a.) NULL 6.89998e-38
5-359 PF01266 (IPR006076) FAD dependent oxidoreductase Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016491'>'oxidoreductase' == '' ? '': 'oxidoreductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016491)

0
138-225 G3DSA:3.50.50.60 (n.a.) NULL 1.7e-34
227-324 SSF54373 (n.a.) NULL 0.0000058
325-365 G3DSA:3.50.50.60 (n.a.) NULL 1.7e-34
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
28 286 258 - b2660 Escherichia coli 28 280 0.0000000000001 24.4275 172
20 383 363 - MCJ_000200 Mycoplasma conjunctivae 22 385 <1e-50 46.3215 776
16 383 367 - MCAP_0219 Mycoplasma capricolum subsp. capricolum 18 386 <1e-50 42.8954 709
20 381 361 - MYCGA0160 Mycoplasma gallisepticum 36 393 <1e-50 47.7901 860
1 384 383 - MG039 Mycoplasma genitalium 1 384 <1e-50 62.5 1270
19 365 346 - MHP7448_0588 Mycoplasma hyopneumoniae 7448 24 368 <1e-50 41.4986 729
20 348 328 - MMOB2950 Mycoplasma mobile 20 345 <1e-50 45.5927 757
16 383 367 - MSC_0259 Mycoplasma mycoides subsp. mycoides SC 23 391 <1e-50 43.1635 714
19 381 362 - MYPE6370 Mycoplasma penetrans 17 379 <1e-50 45.9016 836
6 365 359 - LIC_12204 Leptospira interrogans serovar Copenhage 2 361 0.00000000001 22.8947 155
18 357 339 - Caulobacter crescentus NA1000 20 360 0.000000003 23.796 135
19 379 360 - Mycoplasma pulmonis 19 380 <1e-50 48.6339 853
External IDs
COG
COG0579R
EC number
1.1.99.5
EC number
1.1.3.21 
Gene ID
877174
GI
13507790
GO
Energy production and conversion
Home COG
C
InterPro
IPR006076|FAD dependent oxidoreductase
InterPro
IPR000437|ProkaryoticMembrane lipoprotein lipid attachment site
InterPro
IPR000711|ATPase, F1 complex, OSCP/delta subunit
Old MP number
MP103
Pathway
Metabolism energy, aerobic
PDB homologs
1AA8-A
Pfam
PF01266
Pfam
PF07992
Pfam
PF00070
Pfam
PF05834
Pfam
PF00890
Pfam
PF01494
Pfam
PF01946
Pfam
PF02558
PID
g1673759
RefSeq
NP_109739.1
Swiss-Prot protein ID
Y051_MYCPN
phylomeDB tree
Y051_MYCPN
UniProt
P75063
Transcription
IMAGE BROWSERS

OPERON OP580 (Genomic Overview)
Region:61000-64655

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn051STRING legend

PDB image(s)

1AA8

PDB 1AA8