Gene glpK (MPN050)
Name
glpK
Stable ID
MPN050
Location
61977 - 63503 -
Sequence
    1  ATGGATCTAA AACAACAATA CATTCTTGCT CTAGATGAAG GAACCAGTTC TTGCCGCACG
   61  ATTGTGTTTG ACAAGGATTT AAACCAAGTA GCGATTGCCC AAAACGAATT TAACCAGTTC
  121  TTTCCTAAGA GTGGTTGGGT CGAACAAGAT CCCTTAGAAA TTTGATCAGT CCAATTAGCT
  181  ACGATGCAAA GTGCTAAAAA TAAGGCACAA ATTAAATCAA ACAACATTGC TGCTGTAGGG
  241  ATTACCAACC AACGGGAAAC CATTGTGTTA TGAAACAAAG AAAATGGTTT GCCCGTTTAC
  301  AATGCAATAG TATGGCAAGA TCAACGCACT GCTAGTTTGT GTGATAAGTT AAACCAAGAC
  361  ACCAAGATAA AGGAGTTTGT CAAGAAACAC ACTGGTTTAC CAATTAACCC TTATTTTAGT
  421  GCCACTAAGA TTGCTTGAAT CTTGGAAAAT GTTCCTTTAG CGCAAAAGAT GCTTAAGGAA
  481  GACAAGTTGT TAGCCGGTAC AATTGATACC TGGTTAATTT GAAAACTAAC GGGTGGTAAG
  541  ATGCATGTAA CTGATGTAAG TAATGCATCG CGTACGCTCT TGTTTGACAT TACCACCATG
  601  ACATGATCAC AAGAGTTAGG CGACATCTTT AAAGTACCTT TATCAATCCT ACCCAAAGTG
  661  ATGCCATCCA ATGCCCACTT TGGTGACATA GTACCGAGTC ATTGATCTAC TAGTGCTACT
  721  GGTATGGTAC CTATTCGTGG GGTTGCCGGT GACCAACAAG CAGCCTTGTT TGGTCAGCTC
  781  TGCGTGGAAC CAGCGATGGT TAAAAACACC TATGGTACAG GTTGTTTTAT GTTGATGAAC
  841  ATCGGTAACG AACTGAAATA CTCCCAACAT AACTTATTAA CAACTGTAGC TTGGCAGTTA
  901  GAAAACCAAA AACCGGTGTA TGCCTTAGAA GGTAGTGTTT TTGTGGCTGG CGCAGCCTTA
  961  AAGTGATTAA GGGATAGTCT TAAGGTAATG TACTCGGCAG CTGAAAGTGA CTTTTATGCT
 1021  AAGCTAGCAC AAAAGGAAGA ACAGGAAGTG GTGTTTGTCC CAGCCTTCAC TGGTTTAGGC
 1081  GCACCTTACT GGGATGCTTC AGCAAGAGGC GCCATCTTTG GGATAGAAGC TAATACCAAA
 1141  AGGGAACATT TAGTAAAAGC TACCTTGGAA GCAATTGCCT TTCAAGCTAA TGACCTGATT
 1201  AAGGCAATGG CTAGTGATTT AAACAGTTCT ATTAAAAAAA TTAAGGCTGA TGGCGGTGCT
 1261  TGCAATTCCA ACTATTTAAT GCAATTTCAA GCTGATATTG CTAACTTAGA GGTGATTATT
 1321  CCTAAGAATG TGGAAACCAC TACCATGGGT GCGGCCTTCC TAGCTGGTTT AGCAGTTAAT
 1381  TATTGAAAGG ACACTAAACA ACTAGAAAAA CTAACTGGAA TCGCTAAGCA GTTCAAAAGT
 1441  CAAATGAACC AAACTGTGCG GGAAAAGAAA TCAAAGCGTT GAAACGAAGC TGTTAAAAGA
 1501  ACACTAAAAT GAGCTAGCTT AGACTAA
Download Sequence
Operon
OP580
Operon location
61000 - 64655
Protein (mpn050)
Name
Glycerol kinase (EC 2.7.1.30) (ATP:glycerol 3-phosphotransferase) (GK)
Stable ID
Mpn050
Molecular Weight
55880
Isoelectric Point
9
Localization
Cytoplasm
Comment -
Sequence
MDLKQQYILALDEGTSSCRTIVFDKDLNQVAIAQNEFNQFFPKSGWVEQDPLEIWSVQLATMQSAKNKAQIKSNNIAAVG
ITNQRETIVLWNKENGLPVYNAIVWQDQRTASLCDKLNQDTKIKEFVKKHTGLPINPYFSATKIAWILENVPLAQKMLKE
DKLLAGTIDTWLIWKLTGGKMHVTDVSNASRTLLFDITTMTWSQELGDIFKVPLSILPKVMPSNAHFGDIVPSHWSTSAT
GMVPIRGVAGDQQAALFGQLCVEPAMVKNTYGTGCFMLMNIGNELKYSQHNLLTTVAWQLENQKPVYALEGSVFVAGAAL
KWLRDSLKVMYSAAESDFYAKLAQKEEQEVVFVPAFTGLGAPYWDASARGAIFGIEANTKREHLVKATLEAIAFQANDLI
KAMASDLNSSIKKIKADGGACNSNYLMQFQADIANLEVIIPKNVETTTMGAAFLAGLAVNYWKDTKQLEKLTGIAKQFKS
QMNQTVREKKSKRWNEAVKRTLKWASLD
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mDLKQQYILALDEGTSScR 1 20 M
Oxidation mLKEDKLLAGTIDTWLIWK 157 176 M
Oxidation LTGGKmHVTDVSNASR 176 192 M
Oxidation VmPSNAHFGDIVPSHWSTSATGmVPIR 220 247 M
Oxidation VMPSNAHFGDIVPSHWSTSATGmVPIR 220 247 M
Oxidation VmPSNAHFGDIVPSHWSTSATGMVPIR 220 247 M
Oxidation NTYGTGcFmLMNIGNELK 269 287 M
Oxidation NTYGTGcFMLmNIGNELK 269 287 M
Oxidation VmYSAAESDFYAK 329 342 M
Oxidation VmYSAAESDFYAk 329 342 M
Oxidation AmASDLNSSIK 402 413 M
Oxidation AmASDLNSSIKK 402 414 M
Oxidation SQmNQTVR 480 488 M
GENE/PROTEIN glpK (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
4-259 G3DSA:3.30.420.40 (n.a.) NULL 0
6-261 SSF53067 (n.a.) NULL 0
6-504 TIGR01311 (IPR005999) Glycerol kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006072'>'glycerol' == '' ? '': 'glycerol';-3-'phosphate' == '' ? '': 'phosphate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006072)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004370'>'glycerol' == '' ? '': 'glycerol'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004370)

0
7-258 PF00370 (IPR018484) Carbohydrate kinase, FGGY, N-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'phosphotransferase' == '' ? '': 'phosphotransferase';'>'phosphotransferase' == '' ? '': 'phosphotransferase'; 'activity' == '' ? '': 'activity';

0
55-505 PTHR10196 (IPR000577) Carbohydrate kinase, FGGY Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'phosphotransferase' == '' ? '': 'phosphotransferase';'>'phosphotransferase' == '' ? '': 'phosphotransferase'; 'activity' == '' ? '': 'activity';

0
55-505 PTHR10196:SF9 (IPR005999) Glycerol kinase Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006072'>'glycerol' == '' ? '': 'glycerol';-3-'phosphate' == '' ? '': 'phosphate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0006072)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004370'>'glycerol' == '' ? '': 'glycerol'; 'kinase' == '' ? '': 'kinase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004370)

0
138-150 PS00933 (IPR018483) Carbohydrate kinase, FGGY, conserved site Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'phosphotransferase' == '' ? '': 'phosphotransferase';'>'phosphotransferase' == '' ? '': 'phosphotransferase'; 'activity' == '' ? '': 'activity';

0
260-504 SSF53067 (n.a.) NULL 0
261-505 G3DSA:3.30.420.40 (n.a.) NULL 0
267-459 PF02782 (IPR018485) Carbohydrate kinase, FGGY, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'phosphotransferase' == '' ? '': 'phosphotransferase';'>'phosphotransferase' == '' ? '': 'phosphotransferase'; 'activity' == '' ? '': 'activity';

0
370-390 PS00445 (IPR018483) Carbohydrate kinase, FGGY, conserved site Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005975'>'carbohydrate' == '' ? '': 'carbohydrate'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0005975)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'phosphotransferase' == '' ? '': 'phosphotransferase';'>'phosphotransferase' == '' ? '': 'phosphotransferase'; 'activity' == '' ? '': 'activity';

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
5 504 499 - MAG4470 Mycoplasma agalactiae 2 497 <1e-50 50.6 1378
7 501 494 - Lactococcus lactis subsp. lactis KF147 3 487 5e-35 25.8687 356
3 500 497 - Caulobacter crescentus NA1000 1 493 <1e-50 44.0476 1075
3 504 501 - MCJ_000230 Mycoplasma conjunctivae 1 500 <1e-50 59.1633 1633
6 479 473 - Lactococcus lactis subsp. lactis KF147 2 462 1e-28 23.3471 301
7 501 494 - Lactococcus lactis subsp. lactis KF147 6 494 <1e-50 47.8788 1252
8 495 487 - Bacillus subtilis subsp. subtilis 1 478 2e-30 22.8457 320
7 460 453 - Bacillus subtilis subsp. subtilis 3 487 0.00000008 21.5686 125
4 455 451 - Bacillus subtilis subsp. subtilis 3 439 0.0000000003 24.1015 146
6 478 472 - Bacillus subtilis subsp. subtilis 2 455 1e-30 23.4568 321
5 502 497 - Bacillus subtilis subsp. subtilis 2 493 <1e-50 48.996 1304
7 495 488 - Bacillus subtilis subsp. subtilis 4 482 5e-32 23.2 334
5 502 497 - Bacillus subtilis subsp. subtilis 2 493 <1e-50 48.996 1303
6 478 472 - Bacillus subtilis subsp. subtilis 2 455 1e-31 23.8683 331
4 455 451 - Bacillus subtilis subsp. subtilis 3 439 0.0000000002 24.359 149
7 460 453 - Bacillus subtilis subsp. subtilis 3 487 0.0000002 21.5686 122
4 507 503 - Rv3696c Mycobacterium tuberculosis 13 516 <1e-50 42.6901 1100
9 468 459 - b3564 Escherichia coli 3 445 5e-17 22.3176 203
4 508 504 - b3926 Escherichia coli 3 501 <1e-50 47.1287 1318
3 488 485 - b2803 Escherichia coli 11 477 0.00000000000004 22.0884 178
6 470 464 - b3580 Escherichia coli 3 453 2e-19 21.8557 224
1 508 507 - MG038 Mycoplasma genitalium 1 508 <1e-50 74.2126 2058
3 464 461 - b2776 Escherichia coli 1 425 0.00000000003 19.7479 153
7 489 482 - b1511 Escherichia coli 13 504 6e-21 25.9188 237
1 504 503 - MCAP_0218 Mycoplasma capricolum subsp. capricolum 1 500 <1e-50 51.5873 1407
5 504 499 - MHP7448_0359 Mycoplasma hyopneumoniae 7448 7 505 <1e-50 54.8 1526
5 505 500 - MMOB2940 Mycoplasma mobile 2 501 <1e-50 60.479 1636
1 504 503 - MSC_0258 Mycoplasma mycoides subsp. mycoides SC 1 500 <1e-50 51.3889 1398
7 500 493 - LIC_11799 Leptospira interrogans serovar Copenhage 4 491 <1e-50 46.0765 1169
6 502 496 - LIC_10629 Leptospira interrogans serovar Copenhage 7 512 <1e-50 33.7187 777
1 504 503 - MYCGA0150 Mycoplasma gallisepticum 6 506 <1e-50 65.7426 1802
1 506 505 - MYPE6360 Mycoplasma penetrans 1 505 <1e-50 60.4743 1706
1 504 503 - Mycoplasma pulmonis 1 502 <1e-50 62.8968 1720
External IDs
COG
COG0554C
EC number
2.7.1.30
Gene ID
876741
GI
13507789
GO
Energy production and conversion, Coenzyme metabolism
Home COG
C
InterPro
IPR001865|Ribosomal protein S2
InterPro
IPR000577|Carbohydrate kinase, FGGY
InterPro
IPR005999|Glycerol kinase
Old MP number
MP104
Pathway
Metabolism
Pathway
central intermediary metabolism
PDB homologs
1bo5_O
PDB homologs
1bot_O
PDB homologs
1gla_G
PDB homologs
1BU6-O
Pfam
PF02782
Pfam
PF00370
PID
g1673760
RefSeq
NP_109738.1
Swiss-Prot protein ID
GLPK_MYCPN
phylomeDB tree
GLPK_MYCPN
UniProt
P75064
Transcription
IMAGE BROWSERS

OPERON OP580 (Genomic Overview)
Region:61000-64655

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn050STRING legend

PDB image(s)

1bo5

PDB 1bo5

1bot

PDB 1bot

1gla

PDB 1gla

1BU6

PDB 1BU6