Gene tsr (MPN025)
Name
tsr
Stable ID
MPN025
Location
30244 - 31110 +
Sequence
    1  ATGCTAGTAA ACATCAAACA AATGTTGCAA CACGCTAAGC AACACCACTA TGCTGTACCC
   61  CACATTAATA TCAATAACTA TGAATGGGCT AAGGCAGTAT TAACAGCGGC TCAGCAGGCC
  121  AAGAGTCCGA TTATTGTCTC CACTTCTGAG GGCGCTTTAA AGTATATTTC CGGACACCAA
  181  GTGGTAGTAC CGATGGTAAA GGGCTTAGTC GATGCTTTAA AGATTACTGT ACCCGTAGCA
  241  CTCCACTTAG ACCATGGTAG TTATGAAGGT TGTAAGGCAG CGTTGCAAGC TGGGTTTAGT
  301  TCCATTATGT TTGATGGCTC GCATTTACCC TTTCAAGAAA ACTTCACTAA ATCCAAGGAG
  361  TTAATTGAAC TAGCTAAACA AACCAATGCT TCTGTGGAAC TAGAAGTGGG TACCTTAGGT
  421  GGGGAAGAAG ATGGTATTGT GGGTCAAGGT GAATTGGCCA ACATTGAAGA GTGCAAGCAA
  481  ATTGCGACCT TAAAACCGGA TGCCTTAGCT GCTGGGATTG GTAACATCCA CGGGCTTTAC
  541  CCCGACAACT GAAAGGGTTT AAACTATGAA CTAATTGAAG CGATTGCTAA AGCGACTAAC
  601  TTACCCTTAG TGCTCCATGG TGGTTCGGGA ATTCCGGAAG CGGATGTCAA AAAAGCAATT
  661  GGCTTAGGCA TTAGCAAGCT CAACATTAAC ACTGAATGTC AACTAGCGTT TGCTAAAGCG
  721  ATTCGGGAAT ATGTGGAAGC CAAGAAGGAC TTAGATACCC ACAATAAGGG CTATGACCCA
  781  CGGAAATTGT TAAAGTCACC TACCCAAGCA ATTGTGGACT GCTGCTTGGA AAAGATGCAG
  841  CTCTGTGGTT CAACCAATAA GGCTTAG
Download Sequence
Operon
OP9
Operon location
29803 - 32900
Protein (mpn025)
Name
Fructose-bisphosphate aldolase (FBP aldolase) (FBPA) (EC 4.1.2.13) 
Stable ID
Mpn025
Molecular Weight
31680
Isoelectric Point
7
Localization
Cytoplasm
Comment fructose 1,6-bisphosphate = glycerone phosphate + D-glyceraldehyde 3-phosphate;
Sequence
MLVNIKQMLQHAKQHHYAVPHININNYEWAKAVLTAAQQAKSPIIVSTSEGALKYISGHQVVVPMVKGLVDALKITVPVA
LHLDHGSYEGCKAALQAGFSSIMFDGSHLPFQENFTKSKELIELAKQTNASVELEVGTLGGEEDGIVGQGELANIEECKQ
IATLKPDALAAGIGNIHGLYPDNWKGLNYELIEAIAKATNLPLVLHGGSGIPEADVKKAIGLGISKLNINTECQLAFAKA
IREYVEAKKDLDTHNKGYDPRKLLKSPTQAIVDCCLEKMQLCGSTNKA
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mLVNIK 1 7 M
Formylation LVNIKQ 2 7
Oxidation SPIIVSTSEGALKYISGHQVVVPmVK 42 68 M
Oxidation YISGHQVVVPmVK 55 68 M
Oxidation YISGHQVVVPmVk 55 68 M
Oxidation AALQAGFSSImFDGSHLPFQENFTk 93 118 M
Oxidation AALQAGFSSImFDGSHLPFQENFTK 93 118 M
Methylation kAIGLGISK 218 227 K
Oxidation SPTQAIVDccLEKmQLcGSTNKA 266 289 M
Oxidation mQLcGSTNkA 279 289 M
Oxidation mQLcGSTNKA 279 289 M
GENE/PROTEIN tsr (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
1-288 PF01116 (IPR000771) Ketose-bisphosphate aldolase, class-II Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004332'>'fructose' == '' ? '': 'fructose';-'bisphosphate' == '' ? '': 'bisphosphate'; 'aldolase' == '' ? '': 'aldolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004332) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008270'>'zinc' == '' ? '': 'zinc'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0008270)

0
1-288 TIGR00167 (IPR000771) Ketose-bisphosphate aldolase, class-II Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004332'>'fructose' == '' ? '': 'fructose';-'bisphosphate' == '' ? '': 'bisphosphate'; 'aldolase' == '' ? '': 'aldolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004332) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008270'>'zinc' == '' ? '': 'zinc'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0008270)

0
1-288 SSF51569 (n.a.) NULL 0
1-288 G3DSA:3.20.20.70 (IPR013785) Aldolase-type TIM barrel Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008152'>'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0008152)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003824'>'catalytic' == '' ? '': 'catalytic'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003824)

0
1-288 PIRSF001359 (IPR000771) Ketose-bisphosphate aldolase, class-II Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004332'>'fructose' == '' ? '': 'fructose';-'bisphosphate' == '' ? '': 'bisphosphate'; 'aldolase' == '' ? '': 'aldolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004332) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008270'>'zinc' == '' ? '': 'zinc'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0008270)

0
2-288 TIGR01859 (IPR011289) Fructose-1,6-bisphosphate aldolase, class 2 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'fructose' == '' ? '': 'fructose';'>'fructose' == '' ? '': 'fructose'; 1

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004332'>'fructose' == '' ? '': 'fructose';-'bisphosphate' == '' ? '': 'bisphosphate'; 'aldolase' == '' ? '': 'aldolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004332) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008270'>'zinc' == '' ? '': 'zinc'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0008270)

0
132-143 PS00806 (IPR000771) Ketose-bisphosphate aldolase, class-II Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006096'>'glycolysis' == '' ? '': 'glycolysis'; ('GO' == '' ? '': 'GO';:0006096)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004332'>'fructose' == '' ? '': 'fructose';-'bisphosphate' == '' ? '': 'bisphosphate'; 'aldolase' == '' ? '': 'aldolase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004332) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0008270'>'zinc' == '' ? '': 'zinc'; 'ion' == '' ? '': 'ion'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0008270)

0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
1 287 286 - MAG0780 Mycoplasma agalactiae 6 290 <1e-50 46.5517 686
3 288 285 - Caulobacter crescentus NA1000 4 329 8e-27 27.381 285
2 288 286 - MCJ_001620 Mycoplasma conjunctivae 3 287 <1e-50 49.1289 726
4 286 282 - MHO_0670 Mycoplasma hominis 5 286 <1e-50 42.9577 603
2 288 286 - Lactococcus lactis subsp. lactis KF147 3 298 <1e-50 43.2432 642
2 288 286 - Bacillus subtilis subsp. subtilis 10 291 <1e-50 40.4844 568
5 288 283 - Bacillus subtilis subsp. subtilis 1 280 <1e-50 43.2056 598
2 288 286 - Bacillus subtilis subsp. subtilis 3 285 <1e-50 43.4483 608
2 288 286 - Bacillus subtilis subsp. subtilis 3 284 <1e-50 40.4844 564
4 278 274 - b2925 Escherichia coli 17 348 7e-17 25.4491 199
2 287 285 - b3137 Escherichia coli 3 283 3e-38 31.058 384
2 288 286 - b2096 Escherichia coli 3 284 1e-36 30.6667 370
1 288 287 - MG023 Mycoplasma genitalium 1 288 <1e-50 73.2639 1135
7 275 268 - Rv0363c Mycobacterium tuberculosis 11 332 9e-17 28.6145 198
1 288 287 - b1773 Escherichia coli 1 277 6e-33 33.7884 338
1 288 287 - MCAP_0616 Mycoplasma capricolum subsp. capricolum 1 281 2e-37 32.5342 371
2 288 286 - MCAP_0136 Mycoplasma capricolum subsp. capricolum 9 296 <1e-50 51.3889 766
2 288 286 - MS53_0354 Mycoplasma synoviae 3 288 <1e-50 53.8194 791
1 282 281 - MHP7448_0573 Mycoplasma hyopneumoniae 7448 2 276 7e-28 28.9116 288
2 288 286 - MHP7448_0014 Mycoplasma hyopneumoniae 7448 3 287 <1e-50 48.7805 679
2 288 286 - MMOB1260 Mycoplasma mobile 6 290 <1e-50 50.6944 731
1 288 287 - MSC_0644 Mycoplasma mycoides subsp. mycoides SC 1 281 3e-38 31.9588 378
2 288 286 - MSC_0139 Mycoplasma mycoides subsp. mycoides SC 9 296 <1e-50 51.3889 761
2 288 286 - MYCGA6610 Mycoplasma gallisepticum 4 290 <1e-50 57.4913 877
2 288 286 - MYPE10340 Mycoplasma penetrans 9 296 <1e-50 52.0833 788
1 246 245 - Mycoplasma pulmonis 3 247 5e-27 28.5156 282
1 288 287 - Mycoplasma pulmonis 1 286 <1e-50 53.9519 797
External IDs
Alias
fba
COG
COG0191G
EC number
4.1.2.13
Gene ID
876888
GI
13507764
GO
Carbohydrate transport and metabolism  
Home COG
G
InterPro
IPR000771|Ketose-bisphosphate aldolase, class-II
InterPro
IPR011289|Fructose-1,6-bisphosphate aldolase, class II
Old MP number
MP129
Pathway
Metabolism energy, Glycolysis
PDB homologs
1rvg_A
PDB homologs
1rv8_A
PDB homologs
1gvf_A
PDB homologs
1DOS-A
Pfam
PF01116
PID
g1673788
RefSeq
NP_109713.1
Swiss-Prot protein ID
ALF_MYCPN
phylomeDB tree
ALF_MYCPN
UniProt
P75089
Transcription
IMAGE BROWSERS

OPERON OP9 (Genomic Overview)
Region:29803-32900

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn025STRING legend

PDB image(s)

1rvg

PDB 1rvg

1rv8

PDB 1rv8

1gvf

PDB 1gvf

1DOS

PDB 1DOS