Gene atpD (MPN598)
Name
atpD
Stable ID
MPN598
Location
719548 - 720975 -
Sequence
    1  ATGAAAAAGG AAAACATTAC ATACGGTAAG GTCCACCAAG TGATTGGCCC GGTAGTTGAT
   61  GTCATCTTTA CGGAAAGTAG TCAGTTACCC CGCATTTACG ATTGTTTGAG TGTTAAGTTA
  121  GCTGGGGAAG AACTGTTTTT GGAAGCCGCG CAGCTAATAG GCGATGACAT TGTGCGCTGC
  181  ATTGCTTTGG GTCCAACTGA AGGGTTAGCA CGCAACGAAA AGGTGACTAA CTATAACCAC
  241  CCGATTGAAG TCCCAGTTGG CAAAAACGTC TTGGGCCGGA TGTTTAATGT TTTGGGTAAA
  301  CCCATTGACG GGAAGGAGGA GTTACCCAAA AAACCACAAC TCCCGATTCA CCGCAAACCA
  361  CCTTCGTTTG ATGACCAGTC CAATACGCTA GAAATCTTTG AAACAGGGAT TAAGGTGATT
  421  GACTTGCTCA CTCCCTATGC CCGTGGTGGT AAGATTGGTT TATTTGGTGG TGCTGGTGTT
  481  GGTAAAACGG TTTTAGTGCA AGAGTTAATC CACAACATTG CTAAGGAACA CTCTGGTTTA
  541  AGTGTGTTTG CTGGTGTGGG GGAACGCACC CGGGAAGGTA ATGATCTCTA CTATGAAATG
  601  ATCCAGGGTG GGGTGATTGA CAAAACTGCT TTAGTGTTTG GTCAGATGAA CGAACCCCCA
  661  GGAGCACGGA TGCGGGTCGC TTTAACGGCG CTTACTATGG CCGAATACTT CCGTGACCAT
  721  GACAACCAGG ATGTCTTGCT CTTCATTGAC AACATCTTCC GTTTTACCCA AGCTGGTAGT
  781  GAGGTATCAG CACTGTTAGG TCGGATGCCA TCAGCCGTGG GTTACCAACC AACGTTGGCG
  841  ACTGAAATGG GGCAATTACA AGAGCGGATT GCTTCCACTA AAACCGGTTC GATTACCTCG
  901  GTGCAAGCGA TCTATGTGCC AGCTGATGAC TTGACTGACC CCGCTCCGGC TACCACCTTT
  961  ACCCACCTGG ATGCTAAAAC GGTGTTAGAC CGGAACATAG CAGCGTTGGG AATTTTTCCA
 1021  GCGATCAATC CCTTAGAGTC TACCAGTCGC TTATTGGATC CTAATATTGT CGGGATTAAC
 1081  CACTATAAGG TAGCGTTAGG GGTGCAAAAC ATCTTACAGC GCTTTGCGGA ACTACAAGAC
 1141  ATTATTGCCA TCTTGGGAAT TGATGAGTTA GCGGATGAGG ACAAGATCAT TGTGGAACGG
 1201  GCACGCCGGA TCCGCAACTT CCTCTCCCAA CCGTTCTTTG TAGCGGAAAA GTTCTCGGGG
 1261  ATTGCTGGGA AGTATGTCCC TTTAAGTGAC ACGATCCAAT CGTTTAAGGA AATCTTGGAC
 1321  GGTAAGCATG ATGATCTCCC CGAACAGGCC TTCTTCTTTG TTGGTACCAT TCAGGAAGCA
 1381  GTGGAGAAAG CGAAGCGGCT TAAAAAAGCT ACTGTTGAGG AGAAATAA
Download Sequence
Operon
OP334
Operon location
719200 - 727573
Protein (mpn598)
Name
ATP synthase subunit beta (EC 3.6.3.14) (F-ATPase subunit beta) (ATP synthase F1 sector subunit beta)
Stable ID
Mpn598
Molecular Weight
52250
Isoelectric Point
5
Localization
Cytoplasm
Comment -
Sequence
MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNH
PIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGV
GKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDH
DNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTF
THLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVER
ARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEEK
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mKKENITYGK 1 11 M
Oxidation mFNVLGKPIDGKEELPK 94 111 M
Oxidation mFNVLGkPIDGKEELPk 94 111 M
Phosphorylation VIDLLtPYAR 139 149 T
Oxidation TrEGNDLYYEmIQGGVIDk 190 209 M
Oxidation TREGNDLYYEmIQGGVIDK 190 209 M
Oxidation EGNDLYYEmIQGGVIDk 192 209 M
Oxidation EGNDLYYEmIQGGVIDK 192 209 M
Oxidation TALVFGQmNEPPGAr 209 224 M
Oxidation TALVFGQmNEPPGAR 209 224 M
Oxidation VALTALTmAEYFR 226 239 M
Oxidation VALTALTmAEYFr 226 239 M
Oxidation VALTALTmAEYFRDHDNQDVLLFIDNIFR 226 255 M
Oxidation mPSAVGYQPTLATEmGQLQEr 269 290 M
Oxidation MPSAVGYQPTLATEmGQLQEr 269 290 M
Oxidation mPSAVGYQPTLATEMGQLQER 269 290 M
Oxidation MPSAVGYQPTLATEmGQLQER 269 290 M
Oxidation mPSAVGYQPTLATEMGQLQEr 269 290 M
Oxidation mPSAVGYQPTLATEmGQLQER 269 290 M
GENE/PROTEIN atpD (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
3-81 G3DSA:2.40.10.170 (n.a.) NULL 3.9e-24
3-381 PTHR15184:SF8 (IPR005722) ATPase, F1 complex, beta subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015986'>'ATP' == '' ? '': 'ATP'; 'synthesis' == '' ? '': 'synthesis'; 'coupled' == '' ? '': 'coupled'; 'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015986)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'complex' == '' ? '': 'complex';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'hydrogen' == '' ? '': 'hydrogen';-'exporting' == '' ? '': 'exporting'; 'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'hydrogen' == '' ? '': 'hydrogen'; 'ion' == '' ? '': 'ion'; 'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'activity' == '' ? '': 'activity';

0
3-381 PTHR15184 (n.a.) NULL 0
6-81 SSF50615 (IPR018118) ATPase, F1/A1 complex, alpha/beta subunit, N-termi Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015992'>'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015992) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046034'>'ATP' == '' ? '': 'ATP'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0046034)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016469'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'two' == '' ? '': 'two';-'sector' == '' ? '': 'sector'; 'ATPase' == '' ? '': 'ATPase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0016469)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'hydrogen' == '' ? '': 'hydrogen'; 'ion' == '' ? '': 'ion'; 'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'activity' == '' ? '': 'activity'; <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity';

2.5e-22
7-467 TIGR01039 (IPR005722) ATPase, F1 complex, beta subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015986'>'ATP' == '' ? '': 'ATP'; 'synthesis' == '' ? '': 'synthesis'; 'coupled' == '' ? '': 'coupled'; 'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015986)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'complex' == '' ? '': 'complex';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'hydrogen' == '' ? '': 'hydrogen';-'exporting' == '' ? '': 'exporting'; 'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity'; <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'hydrogen' == '' ? '': 'hydrogen'; 'ion' == '' ? '': 'ion'; 'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'activity' == '' ? '': 'activity';

0
11-77 PF02874 (IPR004100) ATPase, F1/V1/A1 complex, alpha/beta subunit, N-te Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015992'>'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015992) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0046034'>'ATP' == '' ? '': 'ATP'; 'metabolic' == '' ? '': 'metabolic'; 'process' == '' ? '': 'process'; ('GO' == '' ? '': 'GO';:0046034)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016469'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'two' == '' ? '': 'two';-'sector' == '' ? '': 'sector'; 'ATPase' == '' ? '': 'ATPase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0016469)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'synthase' == '' ? '': 'synthase';'>'hydrogen' == '' ? '': 'hydrogen'; 'ion' == '' ? '': 'ion'; 'transporting' == '' ? '': 'transporting'; 'ATP' == '' ? '': 'ATP'; 'synthase' == '' ? '': 'synthase'; 'activity' == '' ? '': 'activity'; <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'ATPase' == '' ? '': 'ATPase'; 'activity' == '' ? '': 'activity';

0.0000000000000049
82-356 SSF52540 (n.a.) NULL 0
83-351 G3DSA:3.40.50.300 (n.a.) NULL 0
135-349 PF00006 (IPR000194) ATPase, alpha/beta subunit, nucleotide-binding dom Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
148-412 SM00382 (IPR003593) ATPase, AAA+ type, core Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0000166'>'nucleotide' == '' ? '': 'nucleotide'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0000166) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0017111'>'nucleoside' == '' ? '': 'nucleoside';-'triphosphatase' == '' ? '': 'triphosphatase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0017111)

0.000000018
340-349 PS00152 (IPR020003) ATPase, alpha/beta subunit, nucleotide-binding dom Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0
352-469 G3DSA:1.10.1140.10 (n.a.) NULL 0
352-469 SSF47917 (IPR000793) ATPase, F1/V1/A1 complex, alpha/beta subunit, C-te Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015986'>'ATP' == '' ? '': 'ATP'; 'synthesis' == '' ? '': 'synthesis'; 'coupled' == '' ? '': 'coupled'; 'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015986)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'two' == '' ? '': 'two';-'sector' == '' ? '': 'sector'; 'ATPase' == '' ? '': 'ATPase'; 'complex' == '' ? '': 'complex';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'hydrolase' == '' ? '': 'hydrolase';'>'hydrolase' == '' ? '': 'hydrolase'; 'activity' == '' ? '': 'activity';

0
362-468 PF00306 (IPR000793) ATPase, F1/V1/A1 complex, alpha/beta subunit, C-te Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0015986'>'ATP' == '' ? '': 'ATP'; 'synthesis' == '' ? '': 'synthesis'; 'coupled' == '' ? '': 'coupled'; 'proton' == '' ? '': 'proton'; 'transport' == '' ? '': 'transport'; ('GO' == '' ? '': 'GO';:0015986)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'ATPase' == '' ? '': 'ATPase';'>'proton' == '' ? '': 'proton';-'transporting' == '' ? '': 'transporting'; 'two' == '' ? '': 'two';-'sector' == '' ? '': 'sector'; 'ATPase' == '' ? '': 'ATPase'; 'complex' == '' ? '': 'complex';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'hydrolase' == '' ? '': 'hydrolase';'>'hydrolase' == '' ? '': 'hydrolase'; 'activity' == '' ? '': 'activity';

1.5e-24
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
63 350 287 - MAG2930 Mycoplasma agalactiae 68 358 0.000000003 24.3506 130
9 456 447 - MAG2940 Mycoplasma agalactiae 3 447 <1e-50 39.0728 835
55 413 358 - MAG3540 Mycoplasma agalactiae 68 425 3e-18 23.6264 208
9 459 450 - MAG3560 Mycoplasma agalactiae 18 466 <1e-50 72.7273 1689
55 413 358 - MARTH_orf046 Mycoplasma arthritidis 68 425 3e-21 24.3243 233
9 467 458 - MARTH_orf048 Mycoplasma arthritidis 36 495 <1e-50 72.5702 1727
9 456 447 - MARTH_orf256 Mycoplasma arthritidis 3 448 <1e-50 39.4737 845
73 466 393 - MARTH_orf258 Mycoplasma arthritidis 68 452 0.0000002 20.0969 114
9 456 447 - MARTH_orf498 Mycoplasma arthritidis 3 446 <1e-50 38.6313 852
84 350 266 - MARTH_orf499 Mycoplasma arthritidis 83 354 0.000001 21.0145 107
138 350 212 - Caulobacter crescentus NA1000 160 366 0.0000003 25.2252 117
50 410 360 - Caulobacter crescentus NA1000 55 421 2e-36 31.117 371
9 461 452 - Caulobacter crescentus NA1000 65 529 <1e-50 61.8844 1467
29 429 400 - Caulobacter crescentus NA1000 38 438 9e-26 25.5981 278
9 469 460 - MCJ_003470 Mycoplasma conjunctivae 3 462 <1e-50 39.4397 874
1 467 466 - MCJ_006460 Mycoplasma conjunctivae 1 467 <1e-50 67.4468 1638
56 351 295 - MCJ_006480 Mycoplasma conjunctivae 67 364 4e-20 25.6667 224
55 413 358 - MHO_0240 Mycoplasma hominis 68 425 3e-20 22.973 223
3 467 464 - MHO_0260 Mycoplasma hominis 23 489 <1e-50 71.2154 1733
9 456 447 - MHO_3120 Mycoplasma hominis 3 445 <1e-50 40.0442 886
24 454 430 - MHO_3130 Mycoplasma hominis 5 439 0.00000002 21.4751 121
6 467 461 - Lactococcus lactis subsp. lactis KF147 1 467 <1e-50 64.454 1565
58 412 354 - Lactococcus lactis subsp. lactis KF147 71 424 5e-21 25.9053 235
47 351 304 - Bacillus subtilis subsp. subtilis 60 366 2e-25 27.8317 277
9 467 458 - Bacillus subtilis subsp. subtilis 4 469 <1e-50 66.5953 1592
8 384 376 - Bacillus subtilis subsp. subtilis 8 377 7e-39 30.1837 393
8 384 376 - Bacillus subtilis subsp. subtilis 8 377 5e-39 30.1837 394
9 467 458 - Bacillus subtilis subsp. subtilis 4 469 <1e-50 66.5953 1592
47 351 304 - Bacillus subtilis subsp. subtilis 60 366 2e-25 27.8317 278
56 435 379 - b3734 Escherichia coli 69 446 3e-28 25.7576 300
9 467 458 - b3732 Escherichia coli 4 460 <1e-50 66.8845 1616
138 386 248 - b3783 Escherichia coli 160 391 0.000008 23.4375 106
58 445 387 - MYCGA3040 Mycoplasma gallisepticum 71 468 2e-17 24.9389 201
7 469 462 - MYCGA3060 Mycoplasma gallisepticum 6 469 <1e-50 79.0948 1899
1 469 468 - MG399 Mycoplasma genitalium 2 470 <1e-50 92.1109 2302
82 411 329 - MG401 Mycoplasma genitalium 95 423 1e-18 24.4776 209
8 384 376 - b1941 Escherichia coli 28 407 3e-29 27.5064 309
58 440 382 - Rv1308 Mycobacterium tuberculosis 74 473 2e-27 27.1605 293
7 467 460 - Rv1310 Mycobacterium tuberculosis 19 482 <1e-50 59.7849 1422
89 361 272 - Rv1297 Mycobacterium tuberculosis 289 556 0.000001 25.2669 114
9 456 447 - MCAP_0359 Mycoplasma capricolum subsp. capricolum 3 447 <1e-50 38.7528 865
131 350 219 - MCAP_0358 Mycoplasma capricolum subsp. capricolum 133 349 0.000001 24 109
2 468 466 - MCAP_0084 Mycoplasma capricolum subsp. capricolum 10 474 <1e-50 68.3083 1668
58 351 293 - MCAP_0082 Mycoplasma capricolum subsp. capricolum 71 366 1e-20 25.8389 229
74 351 277 - MS53_0465 Mycoplasma synoviae 68 346 0.0000000002 22.1053 141
9 459 450 - MS53_0464 Mycoplasma synoviae 3 449 <1e-50 38.0531 862
63 351 288 - MS53_0407 Mycoplasma synoviae 76 366 2e-19 25.9386 217
9 466 457 - MS53_0405 Mycoplasma synoviae 7 464 <1e-50 71.8615 1683
9 459 450 - MS53_0160 Mycoplasma synoviae 2 449 <1e-50 38.7168 855
56 351 295 - MS53_0159 Mycoplasma synoviae 49 347 0.0000000003 22.5806 138
82 350 268 - MHP7448_0479 Mycoplasma hyopneumoniae 7448 65 340 0.00000003 23.2143 121
2 467 465 - MHP7448_0053 Mycoplasma hyopneumoniae 7448 3 465 <1e-50 67.8112 1657
56 410 354 - MHP7448_0051 Mycoplasma hyopneumoniae 7448 68 421 1e-21 24.1758 237
134 350 216 - MMOB2970 Mycoplasma mobile 128 344 0.0000001 22.6244 115
9 456 447 - MMOB2960 Mycoplasma mobile 4 450 <1e-50 40.98 935
69 351 282 - MMOB2110 Mycoplasma mobile 82 366 4e-16 24.3902 189
9 468 459 - MMOB2080 Mycoplasma mobile 5 461 <1e-50 72.1739 1738
2 463 461 - MMOB1670 Mycoplasma mobile 293 759 <1e-50 45.5508 987
83 351 268 - MMOB1660 Mycoplasma mobile 73 345 0.000000000003 25.3571 155
58 351 293 - MSC_0887 Mycoplasma mycoides subsp. mycoides SC 71 366 4e-20 25.8389 224
2 468 466 - MSC_0885 Mycoplasma mycoides subsp. mycoides SC 9 473 <1e-50 67.8801 1660
131 350 219 - MSC_0619 Mycoplasma mycoides subsp. mycoides SC 133 349 0.00000008 24.8889 118
9 456 447 - MSC_0618 Mycoplasma mycoides subsp. mycoides SC 3 447 <1e-50 38.7528 878
138 389 251 - LIC_12636 Leptospira interrogans serovar Copenhage 223 457 0.0000008 22.0472 114
9 352 343 - LIC_11391 Leptospira interrogans serovar Copenhage 30 368 1e-39 30.4598 396
9 468 459 - LIC_11243 Leptospira interrogans serovar Copenhage 4 466 <1e-50 64.8707 1572
55 475 420 - LIC_11241 Leptospira interrogans serovar Copenhage 72 491 5e-25 25.7471 271
9 456 447 - MYCGA6570 Mycoplasma gallisepticum 3 449 <1e-50 39.0351 845
102 351 249 - MYCGA6560 Mycoplasma gallisepticum 86 343 0.000000000002 24.3346 158
9 459 450 - MYPE620 Mycoplasma penetrans 300 750 <1e-50 74.1722 1771
61 437 376 - MYPE600 Mycoplasma penetrans 74 458 5e-24 25.2525 259
83 289 206 - Mycoplasma pulmonis 74 282 0.000000007 22.4299 127
9 456 447 - Mycoplasma pulmonis 3 456 <1e-50 41.8301 922
9 475 466 - Mycoplasma pulmonis 2 467 <1e-50 38.6412 868
88 377 289 - Mycoplasma pulmonis 78 370 0.000000000004 21.5488 156
82 410 328 - Mycoplasma pulmonis 95 422 2e-20 26.4881 226
1 465 464 - Mycoplasma pulmonis 1 462 <1e-50 72.043 1734
9 463 454 - Mycoplasma pulmonis 212 671 <1e-50 44.7312 1019
133 351 218 - Mycoplasma pulmonis 126 346 0.00000000000003 26.3393 174
External IDs
COG
COG0055C
EC number
3.6.3.14
Gene ID
877122
GI
13508337
GO
Energy production and conversion 
Home COG
C
InterPro
IPR003593|AAA ATPase
InterPro
IPR004100|ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal
InterPro
IPR000793|ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal
InterPro
IPR005722|ATPase, F1 complex, beta subunit
InterPro
IPR000194|ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding
Old MP number
MP244
Pathway
Metabolism energy 
PDB homologs
1sky_E
PDB homologs
1kmh_B
PDB homologs
1fx0_B
Pfam
PF08477
Pfam
PF02874
Pfam
PF00306
Pfam
PF00006
PID
g1673912
RefSeq
NP_110287.1
Swiss-Prot protein ID
ATPB_MYCPN
phylomeDB tree
ATPB_MYCPN
UniProt
Q50331
Transcription
IMAGE BROWSERS

OPERON OP334 (Genomic Overview)
Region:719200-727573

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn598STRING legend

PDB image(s)

1sky

PDB 1sky

1kmh

PDB 1kmh

1fx0

PDB 1fx0