Gene rpoB (MPN516)
Name
rpoB
Stable ID
MPN516
Location
632286 - 636461 -
Sequence
    1  ATGTCACAAA AACCTAGTTT CTTTCAGAAA AAATACTCAC CCACTGCTAC CCGCCGTTAC
   61  TATGGCAAAA TTGCCACTGA TTTTGTGCAA CCTAATCTGG CTGATATTCA GATTAGGAGC
  121  TATCAAACTT TTCTAGATCA CGATCTGGAA AACCTGATTG CTGCTTACTT TCCAATTAAG
  181  TCCCCTAATG ATCGTTACAC GATCAACTTT AAGGGTTTGC GTCGTACCGC TCCTGAACGT
  241  AATGAAGCCC AATCACGCTC TGAGTCCAAG ACCTATGAAA TTGGTATTTA CGCTGACTTA
  301  GAATTAATTG ATTCCGCTAC CGGAACCATT AAAAAGCCGC GCAAATCCAA GAAGAACAGT
  361  GCCACCAGTA GTGTCGATGG CGTTTTCTTA ACTAACTTAC CATTGATTAC CCGCGATGGG
  421  GTCTTTATTG TCAACGGGAT TGAGAAGTTT GTGATTGCCC AAATTACCCG TTCACCGGGG
  481  ATCTACATGC TCACTAAGTC CCAGTTAAAA TTGTCTAGTT CGCGTAAACG GGTACAAGAA
  541  GGTTATGTAT GTGAAGTATT ACCAGCCAAC GGTTCGGTAA TGCTGATCTA CATCTCCAAT
  601  AAAAAGAAGA TTGAAGATGC CTTTGTGCAA ATCTTGCTCC GGGATGCTGT ACGTGAAGGG
  661  GCAAAGATCT TCCCTATTAC CACCTTGCTC AAAGCCTTTG GGATGAGTGG CAAGGAAATC
  721  CTCAAAGTTT TCAAAAACAA CGAGTTTATT ACCCGTTCCT TAGAAGCGGA AGTCTACAAC
  781  GCTAAGGATT TCTTAAACAA CGTTGACCCT GAAATTAAAA ACTTATTAAG GGAATTCCGC
  841  GATGGCAAAA CTGATCTCCG CCGTAAGGGG ATTGCCTCTG ACCAAAAGAT CCGCAGCTTA
  901  GTGAGTGACT ATGTCCTTTT AGAAAAGGAA CACAAAGCGC TCAGTGAAGC TAAACCAAAT
  961  GACCCTAAAG TAGGTCAGTT AGAAGCGGAC ATGGATGAGT TGATGGATAA AATCATCACC
 1021  GAACGGGCTG CTAAACACAT TGTTCATGAA TTGTCCATTT CACTACGTGG TTTAGAAAAC
 1081  ACCGATGAAT GTCCGGAAAA CAGTTACCAC GCTTTACTGT GTTCACGTTT CTTCCGTCAA
 1141  AGAAGGTATA ACCTCTCCGC TGCTGGTCGT TATAAGGTAT CACGTAAGTT AAGAATTACC
 1201  GAGCGGATTT ACCAAAAAAC ACTTGCTTGT GACCTTCATT TAAAAAACGG GGAACTCTTA
 1261  TTAAAGAAGG GCACCTTATT AGTTAAAGAA GAAATCGACA AGATTAAGCA AGCTGCCCAA
 1321  AACAACCAAA TTGACTTTGT CCAAAAGATT AAGTTAACCA CTGATGGTAG TGCTGTTAAC
 1381  CTTTCCCCTG AATCGTTGTT GTATGAATCA CTTGATGTTT ATGTGAACAA CGACAACTTC
 1441  GATGTATCCG TGCCAGTGGT GGGGATCCAC AACGATAACG ATCTCAATAA GGCAATTACT
 1501  TTAAGTGACT TTATTGCCTC GATTAGTTAT GTGATTAACA TCCCTTCGGC CATCGGTAAG
 1561  TACGATGACA TTGATCACTT AGGTAACAAA CGCGTCAAGT TAATTAACGA GTTAATTAGT
 1621  TCCCGTTTGG AAAGTGGAAT CACCCGCATG GAGCGCTTCT TAAAGGAAAA GCTCACAATT
 1681  GCTGATGGAG TGAACCGTGG TCAACAAATT AACGAAGAGG GTCAAGTAAT TGAACAAGCG
 1741  GAAAAGAAGG AATTGACCAT TAAATCCTTA ATTAATTCCA AACCTATTCA AATTGTCATT
 1801  CGTGACTTCT TCAACACTCA CCAGTTGACC CAGTTCTTAG ATCACCAAAA TCCACTTTCA
 1861  GAATTAAGTA ATAAGCGCCG GATTTCCGCC ATGGGTCCAG GGGGTATCTC CCGCGAAGAC
 1921  CCGAACTTGG ATATCCGGGA TGTGCACTAT TCCCAATATG GTCGGATTTG TCCAATTGAA
 1981  ACACCGGAAG GGATGAACAT TGGTTTAATC ATGTCGTTGG CTTCCTTTGC CAAGATTGAC
 2041  GAAAACGGAT TCCTAATGGC GCCTTACCGC AAGATTAAAA ATGGTGTCAT TACCGATGAA
 2101  GTTGAATACC TCACGGCATT AAGGGAAGAC GAGCACATTA TTGCCGAAAT CTCTTCGTTG
 2161  GTCAACATTG ACGAAAACAA CAAGATCTTA GATAAGGAAA TTATTGGTCG TTACCGCTCG
 2221  ATGCAAGGGT TGTATGATCC CTCGAAGATT GACTACATCG ACGTGGCCCC TCATCAGGTA
 2281  GTGTCCATCG GTTCGTCCTT AATTCCCTTC TTGGAAAACG ATGACTCAGC GCGGGCATTG
 2341  ATGGGTACCA ACATGCAACG CCAAGCCTAT CCTTTAATTA AGCCTTACGC TCCCGTTGTG
 2401  GGTACAGGTC AAGAGTACAA GATTGCTCGC GACTCCGGCT TGACGATGTT AGCACCTTGC
 2461  TCAGGTACGG TAAAGTATGT AGACAACAGT AAGATCACGA TTGAAAGTGA CAGTGGTGAA
 2521  CAGCACACTT TGGATCTAAT TAAGTTTGAA CGTTCCAACC AAAATACCTG CTACAACCAC
 2581  GTTCCCTTAG TAGAAAAGGG GCAACGGGTA ACTAAGGACG AAGTGATTGC TGATGGTCCT
 2641  GCAGTTAACA AGAGTGAGCT GTCTTTAGGG CAAAATGTCC TTGTCGCCTT TACGACCTGA
 2701  AACGGGTACA ACTATGAGGA TGCGATAGTG ATTTCCGAGC GCTTAGTGAA GGATGATGTT
 2761  CTAACCTCCT TAACGATTAA CGAATACGTA GCCCAGTGTT TATCGACCAA AAACGGTGAT
 2821  GAACAAATTA CCCGTGATAT CCCCAACGTT AGTGATGCTA ACAAGCGTTA CTTAGATGAA
 2881  AACGGCATTA TCATGGTCGG TGCTGAAGTT AAGGAAGGTG ATGTCCTTGT CGGTAAGGTA
 2941  TCCCCTAAGG GACAGGTTGA AGTATCACCT GAAGAAAAGC TGTTTAAGGC CATTTTCCCT
 3001  GAAAGTGTGC AAAACGTCCG TGACTCTTCC TTAAAGCTCC CTCATGGTGG TGATGGGATT
 3061  GTGTCCTGTG TCAAGCGTTT TAGCATTGCC AACGGTAATG AACTTAATGA TGGTGTCATC
 3121  GAAATGATTA AGGTCTATGT GGTGCAAAAA CGCAAGATCC AAATCGGAGA TAAGTTGGCA
 3181  GGGCGCCATG GTAACAAAGG GGTTATCTCT AAGGTTGTCC CAGTAGCGGA CATGCCCCAC
 3241  TTAGAAGATG GTACTCCAGT CGACATCCTC TTAAACCCAC TGGGGGTACC GAGTCGGATG
 3301  AATATTGGCC AAATCTTTGA AATGCACTTG GGTTATGCAG CACATAACCT TGCCAAGCGA
 3361  ATGTTAATTA GTGCTTGTTT TGATGACAAG AAGGCTCAAG CACTTTCAAC CGAAATTAAC
 3421  CAGCCACAGT ACAAACTTGA CCGCTTAATT ACTGGTTTAA AAGCCCAAAT TACGAACCGC
 3481  GGTCTTAAAG ACGAGCAGGC AGCCTTGGCC CAACTCAATA ACGGTGACAT TGCTTTAGTG
 3541  CTCAAGGAAA TCGGCATGAG CTTTGATGAC CTCCACTTTA AAGTAGCGAC CCCGATCTTC
 3601  CAAGGGGTGA ACTTCCAAGA CTTGCAAGAC ATCATGGATG AAGCAGGATT GAAACCAGCG
 3661  GAAACGCACG GGAAGTTCAA GCTGATTGAT GGTCGCACTG GTTTACCATT TGAAAAACCA
 3721  ATTTCCTTGG GAATCATGTA CATTATGAAG TTAAACCACA TGGTTGATGA CAAGATCCAT
 3781  GCTCGCGCTG TCGGTCCTTA CTCCAAGATT ACCCAACAAC CATTGGGTGG TAAATCACAA
 3841  AATGGGGGCC AACGCTTTGG GGAAATGGAA GTGTGAGCCT TGGAAGCTTA CGGCGCTGCT
 3901  TACAACCTTC AGGAATTACT TACCATTAAG TCCGATGATG TGCAGGGCCG GAATAAGGCC
 3961  TATGCCGCGA TCGTTAAGGG CGCTGCCTTC CCCGAACCAG GTATCCCCGA ATCGTTTAAA
 4021  CTGTTAACGA AGGAACTACA AGGGTTAGCG TTGAGTGTGT CCTTTATTTA CGATGACAAC
 4081  ACCCAACAAG ATTCCAACAA CGTTTCAATT CTCCAAGCTG ATGGAGAACA GGACGATCTC
 4141  TTTAATGACT TTGAATTTGA CACGGAGGGT TATTAA
Download Sequence
Operon
OP374
Operon location
628400 - 637070
Protein (mpn516)
Name
DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (Transcriptase subunit beta) (RNA polymerase subunit beta)
Stable ID
Mpn516
Molecular Weight
153010
Isoelectric Point
6
Localization
Cytoplasm
Comment Contains the polymerase activity (initiation and elongation)
Sequence
MSQKPSFFQKKYSPTATRRYYGKIATDFVQPNLADIQIRSYQTFLDHDLENLIAAYFPIKSPNDRYTINFKGLRRTAPER
NEAQSRSESKTYEIGIYADLELIDSATGTIKKPRKSKKNSATSSVDGVFLTNLPLITRDGVFIVNGIEKFVIAQITRSPG
IYMLTKSQLKLSSSRKRVQEGYVCEVLPANGSVMLIYISNKKKIEDAFVQILLRDAVREGAKIFPITTLLKAFGMSGKEI
LKVFKNNEFITRSLEAEVYNAKDFLNNVDPEIKNLLREFRDGKTDLRRKGIASDQKIRSLVSDYVLLEKEHKALSEAKPN
DPKVGQLEADMDELMDKIITERAAKHIVHELSISLRGLENTDECPENSYHALLCSRFFRQRRYNLSAAGRYKVSRKLRIT
ERIYQKTLACDLHLKNGELLLKKGTLLVKEEIDKIKQAAQNNQIDFVQKIKLTTDGSAVNLSPESLLYESLDVYVNNDNF
DVSVPVVGIHNDNDLNKAITLSDFIASISYVINIPSAIGKYDDIDHLGNKRVKLINELISSRLESGITRMERFLKEKLTI
ADGVNRGQQINEEGQVIEQAEKKELTIKSLINSKPIQIVIRDFFNTHQLTQFLDHQNPLSELSNKRRISAMGPGGISRED
PNLDIRDVHYSQYGRICPIETPEGMNIGLIMSLASFAKIDENGFLMAPYRKIKNGVITDEVEYLTALREDEHIIAEISSL
VNIDENNKILDKEIIGRYRSMQGLYDPSKIDYIDVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPVV
GTGQEYKIARDSGLTMLAPCSGTVKYVDNSKITIESDSGEQHTLDLIKFERSNQNTCYNHVPLVEKGQRVTKDEVIADGP
AVNKSELSLGQNVLVAFTTWNGYNYEDAIVISERLVKDDVLTSLTINEYVAQCLSTKNGDEQITRDIPNVSDANKRYLDE
NGIIMVGAEVKEGDVLVGKVSPKGQVEVSPEEKLFKAIFPESVQNVRDSSLKLPHGGDGIVSCVKRFSIANGNELNDGVI
EMIKVYVVQKRKIQIGDKLAGRHGNKGVISKVVPVADMPHLEDGTPVDILLNPLGVPSRMNIGQIFEMHLGYAAHNLAKR
MLISACFDDKKAQALSTEINQPQYKLDRLITGLKAQITNRGLKDEQAALAQLNNGDIALVLKEIGMSFDDLHFKVATPIF
QGVNFQDLQDIMDEAGLKPAETHGKFKLIDGRTGLPFEKPISLGIMYIMKLNHMVDDKIHARAVGPYSKITQQPLGGKSQ
NGGQRFGEMEVWALEAYGAAYNLQELLTIKSDDVQGRNKAYAAIVKGAAFPEPGIPESFKLLTKELQGLALSVSFIYDDN
TQQDSNNVSILQADGEQDDLFNDFEFDTEGY
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Phosphorylation RyyGKIAtDFVQPNLADIQIR 19 40 T
Oxidation DGVFIVNGIEKFVIAQITRSPGIYmLTK 139 167 M
Oxidation SPGIYmLTk 158 167 M
Oxidation SPGIYmLTK 158 167 M
Oxidation IFPITTLLKAFGmSGKEILK 223 243 M
Oxidation AFGmSGKEILK 232 243 M
Oxidation ALSEAKPNDPKVGQLEADmDELMDKIITER 313 343 M
Oxidation ALSEAKPNDPKVGQLEADMDELmDKIITER 313 343 M
Oxidation VGQLEADMDELmDK 324 338 M
Oxidation VGQLEADmDELMDk 324 338 M
Oxidation VGQLEADmDELmDK 324 338 M
Oxidation VGQLEADMDELmDk 324 338 M
Oxidation VGQLEADmDELMDK 324 338 M
Oxidation VGQLEADmDELmDk 324 338 M
Oxidation VGQLEADmDELMDKIITER 324 343 M
Oxidation VGQLEADMDELmDKIITER 324 343 M
Oxidation VGQLEADmDELmDKIITER 324 343 M
Oxidation LESGITRmER 543 553 M
Oxidation RISAmGPGGISR 627 639 M
Oxidation iSAmGPGGISR 628 639 M
Oxidation ISAmGPGGISR 628 639 M
Oxidation ISAmGPGGISr 628 639 M
Oxidation ISAmGPGGISREDPNLDIR 628 647 M
Oxidation IcPIETPEGmNIGLIMSLASFAK 656 679 M
Oxidation IcPIETPEGMNIGLImSLASFAK 656 679 M
Oxidation IDENGFLmAPYR 679 691 M
Oxidation IDENGFLmAPYRK 679 692 M
Oxidation SmQGLYDPSk 740 750 M
Oxidation SmQGLYDPSK 740 750 M
Oxidation SmQGLYDPSKIDYIDVAPHQVVSIGSSLIPFLENDDSAR 740 779 M
Oxidation ALmGTNmQr 779 788 M
Oxidation ALmGTNmQR 779 788 M
Oxidation ALMGTNmQR 779 788 M
Oxidation ALmGTNMQr 779 788 M
Oxidation ALmGTNMQR 779 788 M
Oxidation DSGLTmLAPcSGTVk 811 826 M
Oxidation DSGLTmLAPcSGTVK 811 826 M
Oxidation YLDENGIImVGAEVK 957 972 M
Oxidation YLDENGIImVGAEVKEGDVLVGK 957 980 M
Oxidation YLDENGIImVGAEVKEGDVLVGKVSPK 957 984 M
Oxidation FSIANGNELNDGVIEmIK 1027 1045 M
Oxidation VVPVADmPHLEDGTPVDILLNPLGVPSR 1072 1100 M
Oxidation mNIGQIFEMHLGYAAHNLAK 1100 1120 M
Oxidation mNIGQIFEmHLGYAAHNLAK 1100 1120 M
Oxidation MNIGQIFEmHLGYAAHNLAK 1100 1120 M
Oxidation mNIGQIFEmHLGYAAHNLAKR 1100 1121 M
Oxidation MNIGQIFEmHLGYAAHNLAKR 1100 1121 M
Oxidation RmLISAcFDDKK 1120 1132 M
Oxidation RmLISAcFDDKKAQALSTEINQPQYK 1120 1146 M
Oxidation mLISAcFDDKK 1121 1132 M
Oxidation mLISAcFDDKKAQALSTEINQPQYK 1121 1146 M
Oxidation GLKDEQAALAQLNNGDIALVLKEIGmSFDDLHFK 1161 1195 M
Oxidation EIGmSFDDLHFK 1183 1195 M
Oxidation VATPIFQGVNFQDLQDImDEAGLKPAETHGK 1195 1226 M
Oxidation FKLIDGRTGLPFEKPISLGImYImK 1226 1251 M
Oxidation LIDGRTGLPFEKPISLGIMYImK 1228 1251 M
Oxidation LIDGRTGLPFEKPISLGImYImK 1228 1251 M
Oxidation LIDGRTGLPFEKPISLGImYIMK 1228 1251 M
Oxidation TGLPFEKPISLGImYImK 1233 1251 M
Oxidation TGLPFEKPISLGImYIMK 1233 1251 M
Oxidation TGLPFEKPISLGIMYImK 1233 1251 M
Oxidation LNHmVDDkIHAr 1251 1263 M
Oxidation LNHmVDDKIHAR 1251 1263 M
Oxidation FGEmEVWALEAYGAAYNLQELLTIK 1286 1311 M
Oxidation FGEmEVWALEAYGAAYNLQELLTIKSDDVQGR 1286 1318 M
GENE/PROTEIN rpoB (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
15-1355 TIGR02013 (IPR010243) DNA-directed RNA polymerase, beta subunit, bacteri Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
16-1373 SSF64484 (n.a.) NULL 0
30-157 G3DSA:3.90.1100.10 (n.a.) NULL 0
32-607 PF04563 (IPR007644) RNA polymerase, beta subunit, protrusion Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0.0000000000000083
175-247 G3DSA:3.90.1110.10 (n.a.) NULL 9.1e-27
331-412 G3DSA:3.90.1110.10 (n.a.) NULL 9.1e-27
498-523 G3DSA:3.90.1110.10 (n.a.) NULL 9.1e-27
524-689 G3DSA:3.90.1100.10 (n.a.) NULL 0
587-1379 PTHR20856 (IPR015712) DNA-directed RNA polymerase, subunit 2 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0032549'>'ribonucleoside' == '' ? '': 'ribonucleoside'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0032549)

0
587-1379 PTHR20856:SF3 (n.a.) NULL 0
611-679 PF04565 (IPR007645) RNA polymerase Rpb2, domain 3 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

9e-24
689-756 PF10385 (IPR019462) DNA-directed RNA polymerase, beta subunit, externa Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'>'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

1.7e-17
690-756 G3DSA:2.30.150.10 (n.a.) NULL 5.5e-18
759-813 G3DSA:3.90.1100.10 (n.a.) NULL 0
816-1280 PF00562 (IPR007120) DNA-directed RNA polymerase, subunit 2, domain 6 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
817-885 G3DSA:2.40.50.100 (n.a.) NULL 2.9e-24
886-916 G3DSA:2.40.270.10 (n.a.) NULL 0
921-1054 G3DSA:2.40.50.150 (IPR014724) RNA polymerase Rpb2, OB-fold 1.4013e-45
1055-1146 G3DSA:2.40.270.10 (n.a.) NULL 0
1056-1068 PS01166 (IPR007121) RNA polymerase, beta subunit, conserved site Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
1184-1258 G3DSA:2.40.270.10 (n.a.) NULL 0
1282-1355 PF04560 (IPR007641) RNA polymerase Rpb2, domain 7 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

1.1e-25
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
467 1052 585 - b3987 Escherichia coli 384 958 <1e-50 43.7396 1319
1025 1355 330 - b3987 Escherichia coli 1032 1339 <1e-50 49.8489 1319
18 244 226 - b3987 Escherichia coli 12 224 0.0000000000003 23.6287 1319
336 1128 792 - MARTH_orf212 Mycoplasma arthritidis 238 1017 <1e-50 43.0504 1628
1166 1353 187 - MARTH_orf212 Mycoplasma arthritidis 984 1166 <1e-50 48.4043 1628
1 263 262 - MARTH_orf212 Mycoplasma arthritidis 1 254 0.0000000002 23.1317 1628
353 1141 788 - MAG6120 Mycoplasma agalactiae 264 1043 <1e-50 42.4845 1591
10 163 153 - MAG6120 Mycoplasma agalactiae 18 162 0.00000000003 25.3247 1591
356 1156 800 - MCJ_006840 Mycoplasma conjunctivae 250 1042 <1e-50 43.1204 1636
1162 1379 217 - MCJ_006840 Mycoplasma conjunctivae 974 1188 <1e-50 46.3636 1636
7 255 248 - MCJ_006840 Mycoplasma conjunctivae 5 234 1e-16 26.378 1636
372 1389 1017 - MCAP_0070 Mycoplasma capricolum subsp. capricolum 339 1285 <1e-50 44.6446 2233
10 284 274 - MCAP_0070 Mycoplasma capricolum subsp. capricolum 6 330 4e-21 25.5193 2233
1 1388 1387 - MYCGA2130 Mycoplasma gallisepticum 1 1379 <1e-50 56.3883 4165
1 1391 1390 - MG341 Mycoplasma genitalium 1 1390 <1e-50 85.0467 6307
356 1156 800 - MHP7448_0617 Mycoplasma hyopneumoniae 7448 250 1041 <1e-50 42.5767 1630
1166 1364 198 - MHP7448_0617 Mycoplasma hyopneumoniae 7448 977 1170 <1e-50 49.7487 1630
10 254 244 - MHP7448_0617 Mycoplasma hyopneumoniae 7448 8 233 0.00000000000003 25.9843 1630
356 1128 772 - MHO_2680 Mycoplasma hominis 259 1018 <1e-50 43.1122 1593
1166 1385 219 - MHO_2680 Mycoplasma hominis 985 1195 <1e-50 49.3333 1593
1 247 246 - MHO_2680 Mycoplasma hominis 1 228 0.00000000001 25 1593
372 1131 759 - MMOB2810 Mycoplasma mobile 274 1023 <1e-50 44.6891 1672
1166 1353 187 - MMOB2810 Mycoplasma mobile 987 1169 <1e-50 51.5957 1672
10 163 153 - MMOB2810 Mycoplasma mobile 7 153 0.0000000002 25 1672
372 1152 780 - MSC_1008 Mycoplasma mycoides subsp. mycoides SC 339 1096 <1e-50 46.8948 1834
1166 1356 190 - MSC_1008 Mycoplasma mycoides subsp. mycoides SC 1036 1221 <1e-50 59.6859 1834
10 284 274 - MSC_1008 Mycoplasma mycoides subsp. mycoides SC 6 330 4e-19 24.9258 1834
1 1354 1353 - MYPE790 Mycoplasma penetrans 1 1333 <1e-50 53.1868 3690
18 397 379 - LIC_10753 Leptospira interrogans serovar Copenhage 9 350 2e-18 24.6819 1569
1169 1388 219 - LIC_10753 Leptospira interrogans serovar Copenhage 1018 1222 <1e-50 49.0909 1569
453 1118 665 - LIC_10753 Leptospira interrogans serovar Copenhage 323 1034 <1e-50 43.8859 1569
355 1135 780 - MS53_0485 Mycoplasma synoviae 265 1036 <1e-50 42.5718 1575
1166 1372 206 - MS53_0485 Mycoplasma synoviae 996 1192 <1e-50 49.7585 1575
4 317 313 - MS53_0485 Mycoplasma synoviae 5 298 0.000000000000002 24.3902 1575
487 1380 893 - Rv0667 Mycobacterium tuberculosis 320 1155 <1e-50 46.6667 2141
18 283 265 - Rv0667 Mycobacterium tuberculosis 38 285 0.0000000000003 21.831 2141
284 1364 1080 - Lactococcus lactis subsp. lactis KF147 194 1149 <1e-50 44.4649 2342
11 283 272 - Lactococcus lactis subsp. lactis KF147 7 249 7e-20 26.9091 2342
503 1028 525 - Caulobacter crescentus NA1000 432 941 <1e-50 46.6165 1291
1029 1355 326 - Caulobacter crescentus NA1000 1054 1353 <1e-50 49.6988 1291
18 244 226 - Caulobacter crescentus NA1000 12 230 2e-16 26.5823 1291
371 1375 1004 - Bacillus subtilis subsp. subtilis 253 1168 <1e-50 46.0333 2284
11 283 272 - Bacillus subtilis subsp. subtilis 7 244 6e-21 27.0073 2284
371 1375 1004 - Bacillus subtilis subsp. subtilis 206 1121 <1e-50 45.8374 2268
58 283 225 - Bacillus subtilis subsp. subtilis 7 197 0.000000000003 25.1101 2268
792 897 105 - Bacillus subtilis subsp. subtilis 1 114 2e-18 42.1053 221
31 257 226 - Bacillus subtilis subsp. subtilis 5 202 7e-18 27.6316 216
31 257 226 - Bacillus subtilis subsp. subtilis 5 202 7e-18 27.6316 216
31 257 226 - Bacillus subtilis subsp. subtilis 5 202 1e-17 27.6316 215
31 235 204 - Bacillus subtilis subsp. subtilis 5 179 0.000000000000005 27.3171 191
31 235 204 - Bacillus subtilis subsp. subtilis 5 179 0.000000000000009 27.3171 190
11 194 183 - Bacillus subtilis subsp. subtilis 1 164 0.00000000000001 26.087 188
21 194 173 - Bacillus subtilis subsp. subtilis 2 155 0.0000000000002 25.8621 178
353 1135 782 - Mycoplasma pulmonis 261 1037 <1e-50 43.7811 1631
1166 1353 187 - Mycoplasma pulmonis 996 1178 <1e-50 52.1277 1631
1 348 347 - Mycoplasma pulmonis 1 317 8e-21 27.0195 1631
499 1135 636 - Mycoplasma pulmonis 114 733 <1e-50 48.4424 1554
1166 1300 134 - Mycoplasma pulmonis 692 821 5e-36 51.8519 1554
499 1135 636 - Mycoplasma pulmonis 114 733 <1e-50 48.4424 1553
1166 1300 134 - Mycoplasma pulmonis 692 821 5e-36 51.8519 1553
499 1135 636 - Mycoplasma pulmonis 114 733 <1e-50 48.4424 1552
1166 1300 134 - Mycoplasma pulmonis 692 821 5e-36 51.8519 1552
499 1135 636 - Mycoplasma pulmonis 114 733 <1e-50 48.2866 1546
1166 1300 134 - Mycoplasma pulmonis 692 821 4e-36 51.8519 1546
904 1088 184 - Mycoplasma pulmonis 1 185 <1e-50 58.3784 559
527 649 122 - Mycoplasma pulmonis 1 104 2e-18 36.5854 214
External IDs
COG
COG0085K
EC number
2.7.7.6
Gene ID
876806
GI
13508255
GO
Transcription
Home COG
K
InterPro
IPR010243|DNA-directed RNA polymerase, beta subunit
InterPro
IPR007645|RNA polymerase Rpb2, domain 3
InterPro
IPR007644|RNA polymerase beta subunit
InterPro
IPR007642|RNA polymerase Rpb2, domain 2
InterPro
IPR007641|RNA polymerase Rpb2, domain 7
InterPro
IPR007121|RNA polymerase, beta subunit
InterPro
IPR007120|RNA polymerase Rpb2, domain 6
Old MP number
MP326
Pathway
Transcription
PDB homologs
1iw7_C
PDB homologs
1smy_C
PDB homologs
1hqm_C
Pfam
PF04565
Pfam
PF04563
Pfam
PF04561
Pfam
PF04560
Pfam
PF00562
PID
g1674000
RefSeq
NP_110204.1
Swiss-Prot protein ID
RPOB_MYCPN
phylomeDB tree
RPOB_MYCPN
UniProt
P78013
Transcription
IMAGE BROWSERS

OPERON OP374 (Genomic Overview)
Region:628400-637070

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn516STRING legend

PDB image(s)

1iw7

PDB 1iw7

1smy

PDB 1smy

1hqm

PDB 1hqm