Gene rpoC (MPN515)
Name
rpoC
Stable ID
MPN515
Location
628410 - 632282 -
Sequence
    1  ATGACAAAGC GTAATAAAAA GAACAACAAG CTGTACAAGA ACATTAAGGC AATTAAGCTT
   61  TCGATTGCTT CCAACGACAC GATCCTAAAC TGATCCGAAG GGGAAGTTAC CAAGGCGGAA
  121  ACGATTAACT ATAAGTCCTT AAAACCCGAA CCTGGTGGTT TGTTTGATGA AGCCATTTTT
  181  GGTCCAGTGA AGGACTATGA GTGTGCTTGT GGGAAGTTTA AGAAGATTAA GTACCGTGGC
  241  GTGCGCTGTG ATCGCTGTGG TGTTTGGGTA ACCGAATCAA TTGTGCGCCG GGAACGTATG
  301  GGCCACATTG CCCTAGTCAG TCCGGTAGCG CACATCTGGA TGTCGAAGGA ACTGCCTTCC
  361  CCTTCCAAGA TCTCCTTAGT GTTAAACATC TCTTATAAGG AAGTGGAACA GGTCTTGTAC
  421  TTTGTTAACT ACATAGTATT AGATACTGGG AAGATCAAAG ATCCCAAGAT CATGCCGTTT
  481  AAGTTTAAGG AAGTGTTGGA CTTAGCAGGC AAGGGTTCTT TAACCACGCG GCAAAAAATG
  541  CGCCGGGTGA TCGGTTACAT CTTCCGGAAC CTGATTAAGA ACAGGAGTAG CGAAGACTAC
  601  CGCAAGGGGA AGATCTTTTA TGAAAGCTTA AAGAACAGTT CGTTACCGTT CTCCTTAAAT
  661  GATGCCTTTA ACTACATTAA GAAGTACACT GGCTTCCGCG TTGGTATCGG GGCTGAAGCC
  721  ATTTTAGAAT TGCTCAACAA GATTGACCTT AACTATGAGT TTAGTAAGCT CAATGATGCG
  781  TTACGGAAGG CTAAGAAGGA TAGTGTTGAG GATGCTAAGG TTAAAAAGAT CTTGCGTCAA
  841  TTGGAAACAA TTAGCTGGTT TAGAAATTCG AAGCTGCACC CGAAAAACAT GATCCTGCAC
  901  ACGGTGCCAG TGATCCCGCC AGACATCCGG CCGATTATCC AGTTAGATGG TGCTAAATTT
  961  ACCACCAGTG ACATTAATAA CTTCTACAGA AGGGTAATTA TCCGTAACGA CCGTTTACGC
 1021  CGCATCTTGG AAGATGGTAC CGTACCTGCC ATTGTGGTTA ACAACGAAAA GCGCTTGTTA
 1081  CAAGAATCAG TTGATGCCTT GTTTGACAAC TCGTCGCGCC ACAAGCCAGC GTTATCCAAA
 1141  GACAAACGTT CCTTGAAGTC ACTCACCGAC CGCTTAAAAG GGAAACAAGG GTTGTTCCGT
 1201  CACAACCTTT TAGGTAAACG GGTGGACTAT TCTGGTCGGA GTGTAATTGT GGTGGGTCCA
 1261  GAACTAAAGA TGTATGAGGT CGGGATTCCA GCATTAATGA TCCTCAAGCT GTTCAAACCA
 1321  TTTATTATTC ACGGGTTAAT TAATAAGTTT GACAGCAACG GTAACGAAAT TAGACCAATT
 1381  GCGTCCTCGA TTCGGCAAGC GGAGGACATG ATTAAAAATC AGGACGACCT GATCTGGGGG
 1441  ATTGTGTATG ATGTCATTAA GGACCGTCCG GTGTTATTAA ACCGGGCACC TACTTTGCAC
 1501  CGTTTGGGAA TACAGGCCTT TGAACCGCGG ATTGTCGATG GGAAAGCGAT TCGCCTACAC
 1561  CCGTTAGTGA CCACTGCTTT TAACGCTGAC TTTGACGGTG ACCAGATGGC GGTGCACGTT
 1621  CCGTTGAGCG AAAATGCCGT TAACGAAGCG CGTGCTATTC TGTTAGCTTC CAAGCACATC
 1681  TTGGGACTAA AAGATGGCCG GCCAATTGTC ACCCCAACCC AGGACATGGT GTTAGGTAAC
 1741  TATTACCTCA CTACTGAGCG TAAGGGTCAA ACGGGTGAAG GCATCATCTT TGGTACCGTG
 1801  CATGAAGCCC GCGCGGCATA CGAAGCGGGC AAGGTGCACC TCCACGCCAT TGTCGGCATT
 1861  AGCACCAAAG CCTTTCCAAA CAAGCACTTT GAAGCTCAAG GTACTCTAAT CACTACGGTT
 1921  GGTAAGATTA TCTTTAACGA TGTGTTAGGG GACAACATCC CTTACATTAA TGAAGGGGAA
 1981  TTTGATGAAC ATGCGTGTCC GCAAAAGTTC ATAGTACCAC CAAGTGGTGA TGTGCGTGCT
 2041  GCGATTGCCG CACACCAAGT GCTCCCTGCC TTTGGTAAGA AGGTCATCTC CAAGTTAATT
 2101  GACTTACTTT ACACGGTGGT TGAATTTAAG GATCTACCAC GGATCTTGGA AAACATTAAG
 2161  GCCTTAGGCT TTAAGTACTC GACCCACTCT TCCACCACTG TATCGGTGTT TGATATTCCG
 2221  AAGTACTCCA ACAAACAGCA GTACTTTGAT GAAGCGGACC AACAGGTCTT GAAGTACAAG
 2281  CAGTTTTACA ACAAGGGTTT ACTGACCGAT GATGAACGGT ATAAACGGGT GGTGAAACTG
 2341  TGAAACGGTG TGAAGGAAAA GGTGTCGAGT GAGATCCAGG ACTTAATTAA ACGTGAAGAG
 2401  TACCGTGATA ACTCGATTGT TGTCATGGCC GATTCCGGGG CGCGGGGTAA TATCTCCAAC
 2461  TTTACCCAGC TGTTTGGGAT GCGGGGGTTA ATGAGTAAGA GCTTTAACTA TGAACGCAAC
 2521  AACCAGTCCA AAATTATTAA GGACACGATT GAGGTTCCTA TTAAGCACTC CTTCCTGGAA
 2581  GGTTTAACGA TTAACGAGTA CTTCAACTCA TCTTATGGGG CGCGTAAGGG GATGACCGAT
 2641  ACCGCCATGA AAACGGCTAA GTCTGGTTAC ATGACCCGTA AACTGGTGGA TGCAACCCAC
 2701  GAATTGATTA TTAACCACGA TGACTGTGGT ACACGCAAGG GAATTGTGGT CGAAGCAATT
 2761  GTGGAAACCA AAACCCGTTC GTTGGTGGAA TCACTGTTTG ACCGCATTGT CAACCGTTAC
 2821  ACGATTGGAC CAATTTTAGA TCCCGAAACC AAGGCGGAAA TTGTCCCTGC TAACAGCCTA
 2881  ATTACCCAAG AGTTAGCCAA GCAAATTTGT GCCACTTCGA TTAAACAAGT GTTAGTGCGC
 2941  TCTGTGATTT ACTGTGAACG CGAAAACGGC GTGTGTCAGT ACTGTTTCGG GGTCGATTTG
 3001  TCCACCGGCA AACTGGTGGA ATTGGGTACC GCTGTGGGTG TAATTGCAGC GCAATCGATC
 3061  GGTGAACCAG GAACCCAGTT AACGATGCGT ACCTTCCACA CCGGGGGGGT TTCGACCGAA
 3121  AACAACTTGG CCCAAGGGTT TGAACGTTTA AAGCAAATCT TTGAAGTAGT CGCCCCTAAG
 3181  GATTACGAGC GCTGTGTCAT TTCTGAAGTT AAGGGGGTAG TTAAATCGAT TACTACCACC
 3241  CAAAACGCGC AGGAAGTGTT GATTGAATCT AGTGTCGATG AACGCACTTA CTCGATTCCG
 3301  TTTAGTGCGC AACTGCGTGT CAAGGTCGGT GATGCAGTAG AACTAGGTTC GAAGATTACC
 3361  GAAGGTTCGA TTGACATTCG CCAGTTATTA CGGGTTGCTG GGATCCAACG GGTACGCCAG
 3421  TACATGATTG TCGAAATCCA AAAGGTGTAC CGTATTCAGG GGATTGAGAT TGCTGATAAG
 3481  TATGTCGAAA TTATTATCCG CCAGTTGACG AGCTTACTCC AAGTAACCGA TGCTGGCAGC
 3541  AGTAACCTGT TTGTGGGTCA ACTGGTACAC AGTCACCACC TCAATGAACT CAACAAGAGC
 3601  TTGTTGCTGT CGGGGAAGAT GCCAGTGATT GCCATTAACC AGGTGTTTGG GATCGATGAG
 3661  GCGGCCAGCA AGTCGAACTC CTTCTTGAGT GCCGCATCCT TCCAAGACAC CAAGAAGATC
 3721  TTGACCGATG CTGCGGTAAA AACCCAAGTT GACTACCTCT TAGGGTTGAA AGAAAACGTG
 3781  ATCATTGGGG GTAAGATCCC GGCTGGTACT GGGTTTTTAA CCGATGAAGA ATTGGCCTAC
 3841  CTCGGTGCCA AAACGGTTCA AGAGGAGTAT TAA
Download Sequence
Operon
OP374
Operon location
628400 - 637070
Protein (mpn515)
Name
DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (EC 2.7.7.6) (Transcriptase subunit beta') (RNA polymerase subunit beta')
Stable ID
Mpn515
Molecular Weight
141900
Isoelectric Point
10
Localization
Cytoplasm
Comment Binds to DNA (non-specifically)
Sequence
MTKRNKKNNKLYKNIKAIKLSIASNDTILNWSEGEVTKAETINYKSLKPEPGGLFDEAIFGPVKDYECACGKFKKIKYRG
VRCDRCGVWVTESIVRRERMGHIALVSPVAHIWMSKELPSPSKISLVLNISYKEVEQVLYFVNYIVLDTGKIKDPKIMPF
KFKEVLDLAGKGSLTTRQKMRRVIGYIFRNLIKNRSSEDYRKGKIFYESLKNSSLPFSLNDAFNYIKKYTGFRVGIGAEA
ILELLNKIDLNYEFSKLNDALRKAKKDSVEDAKVKKILRQLETISWFRNSKLHPKNMILHTVPVIPPDIRPIIQLDGAKF
TTSDINNFYRRVIIRNDRLRRILEDGTVPAIVVNNEKRLLQESVDALFDNSSRHKPALSKDKRSLKSLTDRLKGKQGLFR
HNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFKPFIIHGLINKFDSNGNEIRPIASSIRQAEDMIKNQDDLIWG
IVYDVIKDRPVLLNRAPTLHRLGIQAFEPRIVDGKAIRLHPLVTTAFNADFDGDQMAVHVPLSENAVNEARAILLASKHI
LGLKDGRPIVTPTQDMVLGNYYLTTERKGQTGEGIIFGTVHEARAAYEAGKVHLHAIVGISTKAFPNKHFEAQGTLITTV
GKIIFNDVLGDNIPYINEGEFDEHACPQKFIVPPSGDVRAAIAAHQVLPAFGKKVISKLIDLLYTVVEFKDLPRILENIK
ALGFKYSTHSSTTVSVFDIPKYSNKQQYFDEADQQVLKYKQFYNKGLLTDDERYKRVVKLWNGVKEKVSSEIQDLIKREE
YRDNSIVVMADSGARGNISNFTQLFGMRGLMSKSFNYERNNQSKIIKDTIEVPIKHSFLEGLTINEYFNSSYGARKGMTD
TAMKTAKSGYMTRKLVDATHELIINHDDCGTRKGIVVEAIVETKTRSLVESLFDRIVNRYTIGPILDPETKAEIVPANSL
ITQELAKQICATSIKQVLVRSVIYCERENGVCQYCFGVDLSTGKLVELGTAVGVIAAQSIGEPGTQLTMRTFHTGGVSTE
NNLAQGFERLKQIFEVVAPKDYERCVISEVKGVVKSITTTQNAQEVLIESSVDERTYSIPFSAQLRVKVGDAVELGSKIT
EGSIDIRQLLRVAGIQRVRQYMIVEIQKVYRIQGIEIADKYVEIIIRQLTSLLQVTDAGSSNLFVGQLVHSHHLNELNKS
LLLSGKMPVIAINQVFGIDEAASKSNSFLSAASFQDTKKILTDAAVKTQVDYLLGLKENVIIGGKIPAGTGFLTDEELAY
LGAKTVQEEY
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mGHIALVSPVAHIWMSK 100 117 M
Methylation NMILHTVPVIPPDIRPIIQLDGAk 296 320 K
Oxidation NmILHTVPVIPPDIRPIIQLDGAK 296 320 M
Methylation rILEDGTVPAIVVNNEkR 341 359 K
Oxidation mYEVGIPALMILK 424 437 M
Oxidation MYEVGIPALmILK 424 437 M
Oxidation QAEDmIKNQDDLIWGIVYDVIK 466 488 M
Oxidation QAEDmIKNQDDLIWGIVYDVIKDRPVLLNR 466 496 M
Oxidation AIRLHPLVTTAFNADFDGDQmAVHVPLSENAVNEAR 516 552 M
Oxidation LHPLVTTAFNADFDGDQmAVHVPLSENAVNEAr 519 552 M
Oxidation LHPLVTTAFNADFDGDQmAVHVPLSENAVNEAR 519 552 M
Oxidation HILGLKDGRPIVTPTQDmVLGNYYLTTER 559 588 M
Oxidation DGrPIVTPTQDmVLGNYYLTTEr 565 588 M
Oxidation DGRPIVTPTQDmVLGNYYLTTER 565 588 M
Oxidation REEYRDNSIVVmADSGAR 798 816 M
Oxidation EEYRDNSIVVmADSGAR 799 816 M
Oxidation DNSIVVmADSGAR 803 816 M
Oxidation DNSIVVmADSGAr 803 816 M
Oxidation GNISNFTQLFGmr 816 829 M
Oxidation GNISNFTQLFGmR 816 829 M
Oxidation KGmTDTAMK 876 885 M
Oxidation KGMTDTAmK 876 885 M
Oxidation KGmTDTAMKTAK 876 888 M
Oxidation SGYmTR 888 894 M
Oxidation LVELGTAVGVIAAQSIGEPGTQLTmR 1005 1031 M
Oxidation SLLLSGKmPVIAINQVFGIDEAASK 1200 1225 M
Oxidation mPVIAINQVFGIDEAASK 1207 1225 M
GENE/PROTEIN rpoC (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
3-1272 SSF64484 (n.a.) NULL 0
12-1277 PTHR19376:SF4 (n.a.) NULL 0
12-1277 PTHR19376 (n.a.) NULL 0
13-403 PF04997 (IPR007080) RNA polymerase Rpb1, domain 1 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
17-1277 TIGR02386 (IPR012754) DNA-directed RNA polymerase, subunit beta-prime Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
295-584 SM00663 (IPR006592) RNA polymerase, N-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
405-555 PF00623 (IPR000722) RNA polymerase, alpha subunit Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
559-739 PF04983 (IPR007066) RNA polymerase Rpb1, domain 3 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

5.2e-22
768-858 PF05000 (IPR007083) RNA polymerase Rpb1, domain 4 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0.0000000000018
861-1229 PF04998 (IPR007081) RNA polymerase Rpb1, domain 5 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006350'>'transcription' == '' ? '': 'transcription'; ('GO' == '' ? '': 'GO';:0006350)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003899'>'DNA' == '' ? '': 'DNA';-'directed' == '' ? '': 'directed'; 'RNA' == '' ? '': 'RNA'; 'polymerase' == '' ? '': 'polymerase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003899)

0
1067-1121 G3DSA:2.40.50.100 (n.a.) NULL 0.000000043
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
21 1120 1099 - b3988 Escherichia coli 23 1018 <1e-50 37.7778 1829
1042 1272 230 - b3988 Escherichia coli 1133 1363 2e-37 36.9099 1829
21 1272 1251 - MARTH_orf213 Mycoplasma arthritidis 21 1393 <1e-50 36.6027 1880
715 1270 555 - MAG6110 Mycoplasma agalactiae 840 1405 <1e-50 44.0351 1221
21 721 700 - MAG6110 Mycoplasma agalactiae 18 762 <1e-50 37.9534 1221
21 1270 1249 - MCJ_006830 Mycoplasma conjunctivae 25 1389 <1e-50 35.2605 1883
22 1290 1268 - MCAP_0071 Mycoplasma capricolum subsp. capricolum 14 1255 <1e-50 46.5571 2886
21 1290 1269 - MYCGA2140 Mycoplasma gallisepticum 19 1286 <1e-50 61.0023 4094
21 1290 1269 - MG340 Mycoplasma genitalium 23 1292 <1e-50 90.5512 6115
21 1270 1249 - MHP7448_0616 Mycoplasma hyopneumoniae 7448 23 1388 <1e-50 34.2612 1773
715 1277 562 - MHO_2670 Mycoplasma hominis 825 1394 <1e-50 43.0314 1211
21 752 731 - MHO_2670 Mycoplasma hominis 21 773 <1e-50 37.9747 1211
21 704 683 - MMOB2820 Mycoplasma mobile 23 729 <1e-50 41.2329 1285
715 1271 556 - MMOB2820 Mycoplasma mobile 828 1389 <1e-50 43.2862 1285
22 1290 1268 - MSC_1009 Mycoplasma mycoides subsp. mycoides SC 14 1255 <1e-50 46.7919 2898
22 1290 1268 - MYPE800 Mycoplasma penetrans 15 1288 <1e-50 59.0625 3973
22 1273 1251 - Lactococcus lactis subsp. lactis KF147 14 1180 <1e-50 44.162 2667
1042 1271 229 - LIC_10754 Leptospira interrogans serovar Copenhage 1132 1363 1.99993e-41 36.7521 1821
22 1039 1017 - LIC_10754 Leptospira interrogans serovar Copenhage 14 906 <1e-50 39.8039 1821
715 1270 555 - MS53_0484 Mycoplasma synoviae 838 1404 <1e-50 43.6842 1180
21 656 635 - MS53_0484 Mycoplasma synoviae 19 664 <1e-50 39.497 1180
22 1272 1250 - Rv0668 Mycobacterium tuberculosis 14 1264 <1e-50 37.0735 2154
21 1119 1098 - Caulobacter crescentus NA1000 24 1010 <1e-50 41.2985 1996
1034 1271 237 - Caulobacter crescentus NA1000 1117 1358 2e-35 33.8776 1996
22 1273 1251 - Bacillus subtilis subsp. subtilis 14 1178 <1e-50 45.0794 2764
124 1273 1149 - Bacillus subtilis subsp. subtilis 1 1065 <1e-50 43.5233 2403
21 1270 1249 - Mycoplasma pulmonis 21 1377 <1e-50 35.6628 1905
External IDs
COG
COG0086K
EC number
2.7.7.6
Gene ID
876810
GI
13508254
GO
Transcription
Home COG
K
InterPro
IPR012754|DNA-directed RNA polymerase, subunit beta-prime
InterPro
IPR007083|RNA polymerase Rpb1, domain 4
InterPro
IPR007081|RNA polymerase Rpb1, domain 5
InterPro
IPR007080|RNA polymerase Rpb1, domain 1
InterPro
IPR007066|RNA polymerase Rpb1, domain 3
InterPro
IPR006592|RNA polymerase I subunit A, N-terminal
InterPro
IPR000722|RNA polymerase, alpha subunit
Old MP number
MP327
Pathway
Transcription
PDB homologs
1l9u_D
PDB homologs
1smy_D
PDB homologs
1iw7_D
Pfam
PF05000
Pfam
PF04998
Pfam
PF04997
Pfam
PF04983
Pfam
PF01333
Pfam
PF00623
Pfam
PF00774
PID
g1674001
RefSeq
NP_110203.1
Swiss-Prot protein ID
RPOC_MYCPN
phylomeDB tree
RPOC_MYCPN
UniProt
P75271
Transcription
IMAGE BROWSERS

OPERON OP374 (Genomic Overview)
Region:628400-637070

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn515STRING legend

PDB image(s)

1l9u

PDB 1l9u

1smy

PDB 1smy

1iw7

PDB 1iw7