Gene sigA (MPN352)
Name
sigA
Stable ID
MPN352
Location
418741 - 420240 -
Sequence
    1  ATGTCATCGC CAAAGAAAAA TTTCAAAAAA CCTCAGCCTA AAACTGAAAA TCAAAAACAA
   61  GCACTTAACG AAGAGCGCAT TGCTGAACTT AAAAAGAGTC GTATCCTCGG TAAAAACCGT
  121  CCGTTTAAAA AGATGATTTA CGTTGACACT AAGGCACAAC GTAAACAAAA ACACGAAAAC
  181  GTAGCCTTTT TAAAAACGCT TCAAGAAAAC AAGGAGAGTG ATGTACCAAA GAAGCGTCGC
  241  GGTCGAAAGC CAAAACACGC ACCTTTAAAG GAAAAGAACA ACCTTAAGCT GTTTGATATT
  301  TTAGAAGGCT CTCTAAAGAG TCATACCGAA AATGATGATA CTAACAAGGT AATTAGCCTG
  361  TTGGTGGAGG TGTGGGAGAA AAAGAACAAA AAGAAAGACA ATAACTCGCT TTCCAACAAG
  421  GACATTGTTA ATGTTTTGTC CAAGTTTGAA CTCCCAGATG ATGAAATTAT CTTTGTTTTG
  481  GATGAACTGC GTGACAAGGG AATTGAACTA CCACATGATG TGGAAGAGCA CATCCATGAG
  541  TTCCGTGCTA ACCAAGACTT GTCGATCATT GACGAGGACA TTGAAGAATT AACCACCAAA
  601  AACATCTCTA ATCGTGATAA GGTTGATGAC AACGTACGTT TCTTTCTAGG TTCGCTCGAT
  661  TCTTCCAAGA TGTTGGACTT TGAGTCTGAG CAGCGAATTG CCAAAGTTTT AAACAGTACT
  721  GATGAAGAAT CACGCAAGTA TGCCATTAAT CAACTGGTAA CCTCTAACCT TAGGTTAGTG
  781  GTCTCCATTG CTAAAAAACA CTTGGAAAGA GGATTGGATT TTAATGACCT TATCCAGGAA
  841  GGTAACCTAG GACTTTTAAA GGCCATTTCC AAGTTTAACT GGTCATTGGG TAATAAGTTT
  901  TCCACTTATG CTACTTGGTG GATTAAACAA GCGATTACTC GTGCTATTGC TGATCAAGCA
  961  CGTACGGTTC GGATTCCCGT ACACATGGTG GAAACTATTA ACCGTTTAGC TAAAGCTGAA
 1021  CGTGCCTTAA ACCAAGAATT AGGACGCGAA CCCACCGCGG AAGAGTTAGC GGAAAAAATG
 1081  GGTGGTCAAG CTGAAGGGTT TACAGTTAAA AAGATTGCTG AAATTAAACG TTTAAGCTTA
 1141  GATCCTGTTT CTTTAGATAA AACAGTGGGC CACGATGAAG AATCGCAGTT CGGTGACTTT
 1201  GTGCGTGATA CTGATGCCCA AATGCCCGAT GAGTTTACCG AAAGCCGTTC TAATTACGAA
 1261  AAGATTGATG AGTTGTTAAA CAACTGTTTG TCCGAACAGG AAGAATTAAT TGTGCGGATG
 1321  CGCATTGGTA TGCCACCTTA CAACGAAACC AAAACACTCG ATGAGGTAAG TCAAAAGATT
 1381  AAGATTCCCC GCGAAAAGAT TCGGCAAATA GAAACCAAAG CCATTCGCAA ACTGCGTCAA
 1441  GCAGTGCGTA ATAACCACAT GAGCCTTTCC TTCATGAGGG GAAATGAAAA GAAGGATTAG
Download Sequence
Operon
OP455
Operon location
418160 - 420268
Protein (mpn352)
Name
RNA polymerase sigma factor rpoD (Sigma-A) (EC 2.7.7.6)
Stable ID
Mpn352
Molecular Weight
54890
Isoelectric Point
10
Localization
Cytoplasm
Comment The sigma factor greatly reduces the affinity of RNAP for nonspecific DNA while increasing specificity for certain promoter regions, depending on the sigma factor
Sequence
MSSPKKNFKKPQPKTENQKQALNEERIAELKKSRILGKNRPFKKMIYVDTKAQRKQKHENVAFLKTLQENKESDVPKKRR
GRKPKHAPLKEKNNLKLFDILEGSLKSHTENDDTNKVISLLVEVWEKKNKKKDNNSLSNKDIVNVLSKFELPDDEIIFVL
DELRDKGIELPHDVEEHIHEFRANQDLSIIDEDIEELTTKNISNRDKVDDNVRFFLGSLDSSKMLDFESEQRIAKVLNST
DEESRKYAINQLVTSNLRLVVSIAKKHLERGLDFNDLIQEGNLGLLKAISKFNWSLGNKFSTYATWWIKQAITRAIADQA
RTVRIPVHMVETINRLAKAERALNQELGREPTAEELAEKMGGQAEGFTVKKIAEIKRLSLDPVSLDKTVGHDEESQFGDF
VRDTDAQMPDEFTESRSNYEKIDELLNNCLSEQEELIVRMRIGMPPYNETKTLDEVSQKIKIPREKIRQIETKAIRKLRQ
AVRNNHMSLSFMRGNEKKD
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation mIYVDTK 45 52 M
Oxidation mIYVDTKAQR 45 55 M
Oxidation FFLGSLDSSKmLDFESEQR 214 233 M
Oxidation mLDFESEQR 224 233 M
Oxidation mLDFESEQr 224 233 M
Methylation lVVSIAkkHLER 259 271 K
Oxidation TVRIPVHmVETINR 322 336 M
Oxidation IPVHmVETINr 325 336 M
Oxidation IPVHmVETINR 325 336 M
Oxidation ALNQELGREPTAEELAEKmGGQAEGFTVK 342 371 M
Oxidation ALNQELGREPTAEELAEKmGGQAEGFTVKK 342 372 M
Oxidation mGGQAEGFTVK 360 371 M
Oxidation mGGQAEGFTVk 360 371 M
Oxidation mGGQAEGFTVKK 360 372 M
Oxidation TVGHDEESQFGDFVRDTDAQmPDEFTESR 388 417 M
Oxidation DTDAQmPDEFTESr 403 417 M
Oxidation DTDAQmPDEFTESR 403 417 M
Oxidation IGmPPYNETK 442 452 M
Oxidation NNHMSLSFmR 484 494 M
Oxidation NNHmSLSFmR 484 494 M
GENE/PROTEIN sigA (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
104-321 G3DSA:1.10.601.10 (n.a.) NULL 0
209-322 SSF88946 (IPR013325) RNA polymerase sigma factor, region 2 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

2.99878e-43
247-482 TIGR02937 (IPR014284) RNA polymerase sigma-70 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

4.2e-25
248-493 TIGR02393 (IPR012760) RNA polymerase sigma factor RpoD, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

0
252-322 PF04542 (IPR007627) RNA polymerase sigma-70 region 2 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

8.3e-18
276-289 PS00715 (IPR000943) RNA polymerase sigma-70 factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

0
276-289 PR00046 (IPR000943) RNA polymerase sigma-70 factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

4.49999e-24
300-308 PR00046 (IPR000943) RNA polymerase sigma-70 factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

4.49999e-24
325-379 G3DSA:1.10.10.10 (IPR011991) Winged helix-turn-helix transcription repressor DN 2.7e-22
325-404 SSF88659 (IPR013324) RNA polymerase sigma factor, region 3/4 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

9.90002e-19
331-411 PF04539 (IPR007624) RNA polymerase sigma-70 region 3 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

5.8e-17
387-493 SSF88659 (IPR013324) RNA polymerase sigma factor, region 3/4 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

1.6e-17
424-487 G3DSA:1.10.10.10 (IPR011991) Winged helix-turn-helix transcription repressor DN 1.7e-16
429-480 PF04545 (IPR007630) RNA polymerase sigma-70 region 4 Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

0.0000000074
430-442 PR00046 (IPR000943) RNA polymerase sigma-70 factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

4.49999e-24
452-467 PR00046 (IPR000943) RNA polymerase sigma-70 factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

4.49999e-24
452-478 PS00716 (IPR000943) RNA polymerase sigma-70 factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

0
467-478 PR00046 (IPR000943) RNA polymerase sigma-70 factor Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006352'>'transcription' == '' ? '': 'transcription'; 'initiation' == '' ? '': 'initiation'; ('GO' == '' ? '': 'GO';:0006352) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:'of' == '' ? '': 'of';'>'regulation' == '' ? '': 'regulation'; 'of' == '' ? '': 'of'; 'transcription' == '' ? '': 'transcription';

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003677'>'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0003677) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0003700'>'sequence' == '' ? '': 'sequence';-'specific' == '' ? '': 'specific'; 'DNA' == '' ? '': 'DNA'; 'binding' == '' ? '': 'binding'; 'transcription' == '' ? '': 'transcription'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0003700) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0016987'>'sigma' == '' ? '': 'sigma'; 'factor' == '' ? '': 'factor'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0016987)

4.49999e-24
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
246 492 246 - MAG2650 Mycoplasma agalactiae 260 508 <1e-50 44.0476 553
246 480 234 - MARTH_orf346 Mycoplasma arthritidis 258 494 <1e-50 47.7178 603
199 492 293 - Caulobacter crescentus NA1000 367 651 <1e-50 43.1973 619
248 488 240 - Caulobacter crescentus NA1000 48 289 5e-19 29.3651 219
222 483 261 - MCJ_001150 Mycoplasma conjunctivae 263 525 <1e-50 44.1948 582
189 480 291 - MHO_2150 Mycoplasma hominis 225 519 <1e-50 44.8505 615
148 484 336 - Lactococcus lactis subsp. lactis KF147 114 440 <1e-50 40.3561 627
142 487 345 - Bacillus subtilis subsp. subtilis 35 366 <1e-50 42.7746 663
252 486 234 - Bacillus subtilis subsp. subtilis 37 252 8e-20 30.6383 229
239 479 240 - Bacillus subtilis subsp. subtilis 23 246 0.000000008 29.4118 134
235 478 243 - Bacillus subtilis subsp. subtilis 3 231 0.000000000000004 29.6 188
210 312 102 - Bacillus subtilis subsp. subtilis 8 106 0.00000002 35.9223 130
263 482 219 - Bacillus subtilis subsp. subtilis 2 210 0.0000000002 27.6018 149
239 479 240 - Bacillus subtilis subsp. subtilis 23 246 0.000000008 29.4118 134
230 312 82 - Bacillus subtilis subsp. subtilis 37 115 0.00000002 37.3494 131
252 482 230 - Bacillus subtilis subsp. subtilis 34 253 0.00000000006 28.0172 152
252 486 234 - Bacillus subtilis subsp. subtilis 37 252 8e-20 30.6383 229
210 312 102 - Bacillus subtilis subsp. subtilis 24 122 0.00000005 37.8641 127
216 482 266 - Bacillus subtilis subsp. subtilis 8 258 5e-16 28.5714 196
142 487 345 - Bacillus subtilis subsp. subtilis 35 366 <1e-50 42.7746 663
172 484 312 - b3067 Escherichia coli 331 604 <1e-50 44.0895 602
248 485 237 - Rv2703 Mycobacterium tuberculosis 291 521 <1e-50 50 608
272 479 207 - b1922 Escherichia coli 39 233 0.00000000009 26.1682 149
211 482 271 - b3461 Escherichia coli 15 282 7e-17 26.8293 202
195 492 297 - b2741 Escherichia coli 43 327 <1e-50 35.5705 460
1 499 498 - MG249 Mycoplasma genitalium 1 497 <1e-50 85.4 2176
248 487 239 - LIC_11701 Leptospira interrogans serovar Copenhage 347 579 <1e-50 47.5 593
202 485 283 - MCAP_0503 Mycoplasma capricolum subsp. capricolum 161 493 <1e-50 44.2136 703
190 479 289 - MS53_0455 Mycoplasma synoviae 478 779 <1e-50 40.7895 532
222 483 261 - MHP7448_0060 Mycoplasma hyopneumoniae 7448 406 668 <1e-50 43.6567 581
248 487 239 - MT2783 Mycobacterium tuberculosis 86 318 <1e-50 44.5833 532
150 480 330 - MMOB2890 Mycoplasma mobile 144 473 <1e-50 40.9884 584
202 485 283 - MSC_0466 Mycoplasma mycoides subsp. mycoides SC 177 509 <1e-50 43.9169 702
268 479 211 - LIC_11380 Leptospira interrogans serovar Copenhage 51 253 0.0000001 25.463 122
250 479 229 - MT3385 Mycobacterium tuberculosis 41 257 0.00000000000004 26.8085 178
77 493 416 - MYCGA3890 Mycoplasma gallisepticum 229 638 <1e-50 56.3549 1195
100 485 385 - MYPE8360 Mycoplasma penetrans 29 416 <1e-50 52.4297 988
246 479 233 - Mycoplasma pulmonis 212 447 <1e-50 48.3333 526
External IDs
COG
COG0568K
Gene ID
876928
GI
13508091
GO
Transcription
Home COG
K
InterPro
IPR012760|RNA polymerase sigma factor RpoD, C-terminal
InterPro
IPR013324|Sigma factor, regions 3 and 4
InterPro
IPR013325|Sigma factor, region 2
InterPro
IPR007630|Sigma-70 region 4
InterPro
IPR007627|Sigma-70 region 2
InterPro
IPR000943|Sigma-70 factor
InterPro
IPR007624|Sigma-70 region 3
Old MP number
MP484
Pathway
Transcription, degraded by FtsH (?)
PDB homologs
1smy_F
PDB homologs
1l9u_H
PDB homologs
1iw7_F
PDB homologs
1SIG
Pfam
PF04545
Pfam
PF04542
Pfam
PF04539
PID
g1674175
RefSeq
NP_110040.1
Swiss-Prot protein ID
RPOD_MYCPN
phylomeDB tree
RPOD_MYCPN
UniProt
P78022
Transcription
IMAGE BROWSERS

OPERON OP455 (Genomic Overview)
Region:418160-420268

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn352STRING legend

PDB image(s)

1smy

PDB 1smy

1l9u

PDB 1l9u

1iw7

PDB 1iw7

1SIG

PDB 1SIG