Gene nrdE (MPN324)
Name
nrdE
Stable ID
MPN324
Location
383525 - 385690 +
Sequence
    1  ATGTCAGTTA AAGAAAAGAT TCCTGCTTTC AACACCCAAG AAGACTTAGA AAGCTATATT
   61  TCCTTAAATG CCTACACTAA GGTGTACGGT GATTTTAAGA TGGATTTACA CGCTGTGGAG
  121  GCTTACATCC AAGAGCATGT CAAACCCAAA ACAAAGGTGT TTCACTCCAC CAAGGAACGC
  181  TTAGACTTTC TAGTAAAGAA TGATTATTAC GATGAGAACA TCATCAACAT GTACAGCTTT
  241  GAGCAGTTTG AGGAAATTAC ACGTAAGGCT TACGCTTACC GTTTTCGTTA TGCTAACTTT
  301  ATGGGGGCAT TTAAGTTTTA CAACGCTTAT GCACTGAAAA CCTTTGATGG GAAGTGGTAT
  361  TTAGAAAACT ATGAAGACCG CGTTGTCATG AACGTGCTCT TTTTAGCCAA TGGTAACTAT
  421  AACAAGGCTT TAAAGTTACT CAAACAAATT ATTACCAACC GCTTTCAACC AGCTACCCCA
  481  ACTTTTTTAA ATGCGGGACG AAAAAAACGT GGTGAGTTTG TGTCGTGTTA CTTACTGCGC
  541  ATAGAAGACA ACATGGAATC AATTGGTCGT GCCATTACCA CTACCCTACA GCTCTCCAAG
  601  CGTGATGGTG GGGTGGCGTT ATTGCTCACT AACATCCGCG AATCGGGTGC GCCAATTAAA
  661  AAAATAGAAA ACCAGTCATC AGGCATTATT CCAATTATGA AGCTGTTGGA AGACTCTTTT
  721  TCTTACGCCA ACCAATTAGG GCAAAGACAG GGAGCAGGAG CAGTGTATCT CCATGCCCAC
  781  CACCCCGATG TCATGCAGTT TTTAGACACA AAGCGCGAAA ACGCTGATGA AAAGATCCGG
  841  ATTAAGTCGC TGTCTTTGGG TCTAGTTATT CCCGACATTA CCTTTACTTT AGCTAAAAAC
  901  AATGAGGAGA TGGCCTTGTT TAGTCCGTAT GATGTGTATG AGGAGTATGG CAAACCCTTG
  961  TCAGACATTT CAGTCACGGA AATGTATTAC GAACTGTTAG CGAACCAACG CATTAAAAAG
 1021  ACCTTTATTA ATGCGCGCAA GTTCTTCCAA ACAGTGGCGG AACTGCACTT TGAAAGCGGT
 1081  TATCCTTACA TCTTATTTGA CGATACGGTT AACCGGCGCA ACGCGCACCC CAACCGCATT
 1141  GTCATGTCTA ACCTCTGTAG TGAAATTGTC CAACCCTCCA CTCCATCGGA GTTCCACCAC
 1201  GATTTGGCTT TTAAAAAGGT TGGTAATGAC ATTAGCTGTA ACTTGGGTAG CTTAAACATT
 1261  GCCAAAGCAA TGGAAAGCGG ACCGGAGTTC TCGGAGTTGG TTAAACTAGC GATCGAATCA
 1321  CTTGATTTAG TTTCAAGGGT AAGCAATTTA GAAACGGCTC CATCGATCCA AAAGGGTAAT
 1381  TCCGAAAATC ATGCTTTGGG ATTAGGGGCA ATGAACTTGC ACGGTTTTTT AGCAACTAAC
 1441  CAAATTTATT ACAACTCCCC TGAAGCAATC GACTTTACTA ACATCTTTTT CTATACGGTA
 1501  GCTTACCATG CCTTTAAAGC ATCCAGTGAG CTAGCTTTAG AGAAGGGTAA GTTTAAAAAC
 1561  TTTGAAAACA CCAAGTTTGC TGATGGGAGC TACTTTGATA AATATATCAA AGTAGAACCA
 1621  GACTTTTGAA CACCCAAAAC CGAGCGCGTT AAGGCGTTGT TTCAAAAGTA CCAAGTGGAA
 1681  ATACCAACAC GTGAAAACTG AAAGGAGTTA GCACTCAACA TTCAGAAAAA CGGTTTGGCC
 1741  AATTCCCACT TACTGGCAAT TGCTCCAACG GGTTCAATTT CCTATCTCTC CTCCTGTACT
 1801  CCTTCACTCC AACCGGTAGT ATCCCCGGTA GAAGTGCGCA AGGAAGGTCG GTTGGGACGG
 1861  ATTTATGTAC CGGCTTACCA ACTCAATAAA GACAGTTACC CTTTTTATAA AGATGGTGCT
 1921  TACGAACTGG GTCCCGAACC AATTATTAAC ATAGCAGCAG CGGCACAACA ACACGTCGAT
 1981  CAAGCGATTT CGCTCACCCT ATTTATGACT GATAAGGCTA CCACTCGTGA CCTCAATAAA
 2041  GCTTATATTT ATGCTTTTAA AAAGGGTTGT TCTTCCATTT ACTATGTCCG AGTGCGCCAG
 2101  GAAGTACTAG AGGACAGTGA GGATCACACC ATTCAAATGC AGCAGTGTGA GGCCTGTGTG
 2161  ATTTAA
Download Sequence
Operon
OP127
Operon location
380638 - 385680
Protein (mpn324)
Name
Ribonucleoside-diphosphate reductase subunit alpha (EC 1.17.4.1) (Ribonucleotide reductase)
Stable ID
Mpn324
Molecular Weight
79310
Isoelectric Point
7
Localization
Cytoplasm
Comment -
Sequence
MSVKEKIPAFNTQEDLESYISLNAYTKVYGDFKMDLHAVEAYIQEHVKPKTKVFHSTKERLDFLVKNDYYDENIINMYSF
EQFEEITRKAYAYRFRYANFMGAFKFYNAYALKTFDGKWYLENYEDRVVMNVLFLANGNYNKALKLLKQIITNRFQPATP
TFLNAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSKRDGGVALLLTNIRESGAPIKKIENQSSGIIPIMKLLEDSF
SYANQLGQRQGAGAVYLHAHHPDVMQFLDTKRENADEKIRIKSLSLGLVIPDITFTLAKNNEEMALFSPYDVYEEYGKPL
SDISVTEMYYELLANQRIKKTFINARKFFQTVAELHFESGYPYILFDDTVNRRNAHPNRIVMSNLCSEIVQPSTPSEFHH
DLAFKKVGNDISCNLGSLNIAKAMESGPEFSELVKLAIESLDLVSRVSNLETAPSIQKGNSENHALGLGAMNLHGFLATN
QIYYNSPEAIDFTNIFFYTVAYHAFKASSELALEKGKFKNFENTKFADGSYFDKYIKVEPDFWTPKTERVKALFQKYQVE
IPTRENWKELALNIQKNGLANSHLLAIAPTGSISYLSSCTPSLQPVVSPVEVRKEGRLGRIYVPAYQLNKDSYPFYKDGA
YELGPEPIINIAAAAQQHVDQAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIYYVRVRQEVLEDSEDHTIQMQQCEACV
I
Post translational modifications
Modification Modified sequence Relative start Relative end Amino acid
Oxidation VYGDFKmDLHAVEAYIQEHVKPK 28 51 M
Oxidation mDLHAVEAYIQEHVKPK 34 51 M
Oxidation YANFmGAFK 97 106 M
Oxidation IEDNmESIGr 181 191 M
Oxidation IEDNmESIGR 181 191 M
Oxidation KIENQSSGIIPImK 221 235 M
Oxidation IENQSSGIIPImK 222 235 M
Oxidation IENQSSGIIPImk 222 235 M
Oxidation IVmSNLcSEIVQPSTPSEFHHDLAFK 380 406 M
Oxidation IVmSNLcSEIVQPSTPSEFHHDLAFKK 380 407 M
Oxidation AmESGPEFSELVK 423 436 M
Oxidation AmESGPEFSELVk 423 436 M
Oxidation AmESGPEFSELVKLAIESLDLVSR 423 447 M
Oxidation VRQEVLEDSEDHTIQmQQcEAcVI 698 722 M
GENE/PROTEIN nrdE (Domains Overview)
Click on the features to jump to domain info

 ExportIMG
Domains (InterProScan)
Location (aa) Name (InterPro ID) Description GO terms Sequence Evalue
16-172 SSF48168 (IPR008926) Ribonucleotide reductase R1 subunit, N-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0055114'>'oxidation' == '' ? '': 'oxidation'; 'reduction' == '' ? '': 'reduction'; ('GO' == '' ? '': 'GO';:0055114)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005515'>'protein' == '' ? '': 'protein'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005515)

0
19-95 PF08343 (IPR013554) Ribonucleotide reductase N-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0055114'>'oxidation' == '' ? '': 'oxidation'; 'reduction' == '' ? '': 'reduction'; ('GO' == '' ? '': 'GO';:0055114)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005515'>'protein' == '' ? '': 'protein'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005515)

4.7e-19
99-169 PF00317 (IPR013509) Ribonucleotide reductase large subunit, N-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0055114'>'oxidation' == '' ? '': 'oxidation'; 'reduction' == '' ? '': 'reduction'; ('GO' == '' ? '': 'GO';:0055114)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748) <'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005524'>'ATP' == '' ? '': 'ATP'; 'binding' == '' ? '': 'binding'; ('GO' == '' ? '': 'GO';:0005524)

0.00016
100-699 TIGR02506 (IPR013346) Ribonucleoside-diphosphate reductase, alpha subuni Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0055114'>'oxidation' == '' ? '': 'oxidation'; 'reduction' == '' ? '': 'reduction'; ('GO' == '' ? '': 'GO';:0055114)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

0
110-295 G3DSA:3.20.70.20 (n.a.) NULL 0
154-721 PTHR11573:SF4 (n.a.) NULL 0
154-721 PTHR11573 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

0
173-701 SSF51998 (n.a.) NULL 0
174-696 PF02867 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

0
249-268 PR01183 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

1.3e-33
348-518 G3DSA:3.20.70.20 (n.a.) NULL 0
380-391 PR01183 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

1.3e-33
425-448 PR01183 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

1.3e-33
464-486 PR01183 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

1.3e-33
492-515 PR01183 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

1.3e-33
567-589 PS00089 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

0
578-605 PR01183 (IPR000788) Ribonucleotide reductase large subunit, C-terminal Biological Process:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0006260'>'DNA' == '' ? '': 'DNA'; 'replication' == '' ? '': 'replication'; ('GO' == '' ? '': 'GO';:0006260)

Cellular Component:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0005971'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'complex' == '' ? '': 'complex'; ('GO' == '' ? '': 'GO';:0005971)

Molecular Function:
<'A' == '' ? '': 'A'; 'class' == '' ? '': 'class';=''result' == '' ? '': 'result';' 'target' == '' ? '': 'target';='_'blank' == '' ? '': 'blank';' 'href' == '' ? '': 'href';=''http' == '' ? '': 'http';://'amigo' == '' ? '': 'amigo';.'geneontology' == '' ? '': 'geneontology';.'org' == '' ? '': 'org';/'cgi' == '' ? '': 'cgi';-'bin' == '' ? '': 'bin';/'amigo' == '' ? '': 'amigo';/'term' == '' ? '': 'term';-'details' == '' ? '': 'details';.'cgi' == '' ? '': 'cgi';?'term' == '' ? '': 'term';='GO' == '' ? '': 'GO';:0004748'>'ribonucleoside' == '' ? '': 'ribonucleoside';-'diphosphate' == '' ? '': 'diphosphate'; 'reductase' == '' ? '': 'reductase'; 'activity' == '' ? '': 'activity'; ('GO' == '' ? '': 'GO';:0004748)

1.3e-33
580-623 G3DSA:3.20.70.20 (n.a.) NULL 0
655-697 G3DSA:3.20.70.20 (n.a.) NULL 0
Protein Homology (BLASTP results)
Protein Start Protein End Hit Size Orthologous Organism Orthologous Start Orthologous End Evalue Identity Score Alignment
12 721 709 - b2675 Escherichia coli 10 714 <1e-50 54.0503 2114
64 721 657 - b2234 Escherichia coli 109 761 <1e-50 26.6667 455
17 721 704 - MCJ_000080 Mycoplasma conjunctivae 16 720 <1e-50 68.8293 2688
17 721 704 - MCAP_0101 Mycoplasma capricolum subsp. capricolum 15 720 <1e-50 68.0731 2635
35 721 686 - MYCGA0430 Mycoplasma gallisepticum 30 722 <1e-50 65.2237 2477
1 721 720 - MG231 Mycoplasma genitalium 1 721 <1e-50 87.2399 3442
17 721 704 - MHP7448_0221 Mycoplasma hyopneumoniae 7448 16 720 <1e-50 67.1368 2625
343 689 346 - MMOB0160 Mycoplasma mobile 421 740 4e-16 23.6413 190
121 273 152 - MMOB0160 Mycoplasma mobile 125 280 0.00000000002 25.641 190
17 721 704 - MSC_0853 Mycoplasma mycoides subsp. mycoides SC 18 723 <1e-50 67.9325 2631
15 721 706 - MYPE850 Mycoplasma penetrans 16 725 <1e-50 62.7451 2454
35 721 686 - Lactococcus lactis subsp. lactis KF147 31 722 <1e-50 47.2934 1734
19 721 702 - MS53_0401 Mycoplasma synoviae 14 724 <1e-50 62.8692 2420
19 721 702 - Rv3051c Mycobacterium tuberculosis 27 725 <1e-50 57.8279 2195
155 697 542 - Rv0570 Mycobacterium tuberculosis 173 656 5e-37 23.6615 377
155 699 544 - Caulobacter crescentus NA1000 95 591 3e-32 24.4932 335
12 721 709 - Bacillus subtilis subsp. subtilis 2 700 <1e-50 43.7936 1593
32 721 689 - Bacillus subtilis subsp. subtilis 10 684 <1e-50 44.733 1589
32 721 689 - Bacillus subtilis subsp. subtilis 41 715 <1e-50 43.8672 1564
13 721 708 - Mycoplasma pulmonis 4 711 <1e-50 67.4614 2645
External IDs
COG
COG0209F
EC number
1.17.4.1
Gene ID
876946
GI
13508063
GO
Nucleotide transport and metabolism
Home COG
F
InterPro
IPR013554|Ribonucleotide reductase N-terminal
InterPro
IPR013346|Ribonucleoside-diphosphate reductase, alpha subunit
InterPro
IPR000788|Ribonucleotide reductase large subunit, C-terminal
InterPro
IPR008926|Ribonucleotide reductase R1 subunit, N-terminal
InterPro
IPR013509|Ribonucleotide reductase large subunit, N-terminal
Old MP number
MP512
Pathway
Metabolism nucleotide
PDB homologs
1pem_A
PDB homologs
1peo_A
PDB homologs
1peq_A
PDB homologs
5R1R-A
Pfam
PF00317
Pfam
PF08343
Pfam
PF02867
PID
g1674206
RefSeq
NP_110012.1
Swiss-Prot protein ID
RIR1_MYCPN
phylomeDB tree
RIR1_MYCPN
UniProt
P78027
Transcription
IMAGE BROWSERS

OPERON OP127 (Genomic Overview)
Region:380638-385680

Click on the features to jump to a different MyMpn page

 ExportIMG MyGBrowser GBrowse
STRING image

STRING of Mpn324STRING legend

PDB image(s)

1pem

PDB 1pem

1peo

PDB 1peo

1peq

PDB 1peq

5R1R

PDB 5R1R